Align Benzoate--CoA ligase; Benzoyl-CoA synthetase; EC 6.2.1.25 (characterized)
to candidate 6937793 Sama_1934 long-chain-fatty-acid--CoA ligase (RefSeq)
Query= SwissProt::Q8GQN9 (527 letters) >FitnessBrowser__SB2B:6937793 Length = 558 Score = 164 bits (415), Expect = 8e-45 Identities = 138/521 (26%), Positives = 228/521 (43%), Gaps = 47/521 (9%) Query: 43 YIDDAGSYTYDELALRVNRCGSALRTTLGLQPKDRVLVCVLDGIDFPTTFLGAIKGGVVP 102 +I+ TY +L R + L+ LGL+ DRV + + + + +P G ++ G+V Sbjct: 42 FINMGAVLTYRKLEERSRAFAAYLQNELGLKKGDRVALMMPNLLQYPIALFGVLRAGLVV 101 Query: 103 IAINTLLTESDYEYMLTDSAARVAVVSQELLPLFAPMLGKVPTLEHLVVAG-----GAGE 157 + +N L T + ++ L DS A+ VV ++ P +E +++ G A + Sbjct: 102 VNVNPLYTPRELKHQLIDSGAKTIVVVSNFARTLEEVVDDTP-VESVIITGLGDLLSAPK 160 Query: 158 DSL------------------------AALLATGSEQFEAAPTRPDDHCFWLYSSGSTGA 193 +L +AL Q+ D F Y+ G+TG Sbjct: 161 RTLVNFVVKYIKKLVPKYDLPHAISFRSALQKGRRMQYVKPELDIDTLAFLQYTGGTTGV 220 Query: 194 PKGTVHIHSDLIHTA----ELYARPILGIREGDVVFSAAKLFFAYGLGNGLIFPLAVGAT 249 KG + H +++ YA P+L + + V +A L+ + L + L GA Sbjct: 221 SKGAMLSHGNVVANVLQANGAYA-PLLADGK-EFVVTALPLYHIFALTVNCLLFLHKGAQ 278 Query: 250 AVLMAERPTPAAVFERLRRHQPDIFYGVPTLYASMLANPDCPKEGELRLRACTSAGEALP 309 +L+ A LR++ GV TL+ +++ N + + RL+ G A+ Sbjct: 279 NLLITNPRDIPAFISDLRKYPFTALTGVNTLFNALVNNEEFTQLDFSRLKLSIGGGMAVQ 338 Query: 310 EDVGRRWQARFGVDILDGIGSTEMLHIFLS---NRAGDVHYGTSGKPVPGYRLRLIDEDG 366 V +WQ+ +L+G G TE + N G + G+ G P P +++ D+DG Sbjct: 339 RAVADKWQSITKTRLLEGYGLTEASPLVACCPYNLEG--YNGSIGFPAPSTLMQVRDDDG 396 Query: 367 AEITTAGVAGELQISGPSSAVMYWNNPEKTAATFMGE-WTRSGDKYLVNDEGYYVYAGRS 425 + G GEL GP YW PE+T W +GD ++++G++ R Sbjct: 397 -NVLPQGETGELFAKGPQVMKGYWQRPEETTKVIDANGWLATGDIGYMDEQGFFYIVDRK 455 Query: 426 DDMLKVSGIYVSPIEVESALIAHEAVLEAAVVGWEDEDHLIKPKAFIVLKPGYGAGEALR 485 DM+ VSG V P EVE + H V+E A +G ++ K F+V K Sbjct: 456 KDMILVSGFNVFPNEVEDVVAMHPKVIEVAAIGVPNDASGEIVKVFVVAKD----KSLTE 511 Query: 486 TDLKAHVKNLLAPYKYPRWIEFVDDLPKTATGKIQRFKLRS 526 +D+ H K+ L YK P+ +EF D+LPKT GKI R +LR+ Sbjct: 512 SDVIKHCKHHLTGYKVPKLVEFRDELPKTNVGKILRRELRN 552 Lambda K H 0.319 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 676 Number of extensions: 45 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 527 Length of database: 558 Length adjustment: 35 Effective length of query: 492 Effective length of database: 523 Effective search space: 257316 Effective search space used: 257316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory