Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.110) (characterized)
to candidate 6936996 Sama_1170 electron transfer flavoprotein, alpha subunit (RefSeq)
Query= BRENDA::H6LBB1 (418 letters) >FitnessBrowser__SB2B:6936996 Length = 307 Score = 137 bits (345), Expect = 4e-37 Identities = 98/327 (29%), Positives = 168/327 (51%), Gaps = 30/327 (9%) Query: 74 ITVYVDHIEGQIHPVTFELIGKARELAAVIGHPVYALLMGTNITEKADELLKY-GVDKVF 132 I V +H + T +++ A+ IG V+ L+ G N AD GV KV Sbjct: 3 ILVLAEHDNASLKLDTAKVVSAAK----AIGGEVHLLVAGHNCGAVADAAAAIDGVAKVL 58 Query: 133 VYDKPELKHFVIEPYANVLEDFIEKVKPSSILVGATNVGRSLAPRVAARYRTGLTADCTI 192 V D + E A ++ D S IL A+++G+ PRVAA + Sbjct: 59 VADNAAYAAHLGENLAALMLDLAGNY--SHILAAASSMGKDALPRVAA-----------L 105 Query: 193 LEMKENTDLVQI-------RPAFGGNIMAQIVTENTRPQFCTVRYKVFTAPERVNEPWGD 245 L++ + +++V++ RP + GN MA + + + + + TVR F A G Sbjct: 106 LDVAQLSEVVKVVDANTFVRPIYAGNAMATVESLDDK-KVMTVRPSAFDAAAN----GGS 160 Query: 246 VEMMDIEKAKLVSAIEVMEVIKKEKGIDLSEAETIVAVGRGVKCEKDLDMIHEFAEKIGA 305 + ++K + V + + + +L A IV+ GRG+ ++ ++ + A+K+GA Sbjct: 161 AAIEALDKVFTAKSAFVSQELTVSERPELGNAGIIVSGGRGMGSGENFTLLEKLADKLGA 220 Query: 306 TVACTRPGIEAGWFDARLQIGLSGRTVKPKLIIALGISGAVQFAAGMQNSEYIIAINSDP 365 V +R ++AG+ LQ+G +G+ V P+L IA+GISGA+Q AGM++S+ I+AIN DP Sbjct: 221 AVGASRAAVDAGFVPNDLQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINKDP 280 Query: 366 KAPIFNIAHCGMVGDLYEILPELLTMI 392 +APIF +A + DL+E +P+L+ ++ Sbjct: 281 EAPIFQVADYALEADLFEAVPKLIDLL 307 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 307 Length adjustment: 29 Effective length of query: 389 Effective length of database: 278 Effective search space: 108142 Effective search space used: 108142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory