GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagK in Shewanella amazonensis SB2B

Align N-acetylgalactosamine kinase AgaK; GalNAc kinase; N-acetylglucosamine kinase; GlcNAc kinase; EC 2.7.1.-; EC 2.7.1.59 (characterized)
to candidate 6937023 Sama_1197 putative ROK-family protein (RefSeq)

Query= SwissProt::A0KYQ6
         (308 letters)



>lcl|FitnessBrowser__SB2B:6937023 Sama_1197 putative ROK-family
           protein (RefSeq)
          Length = 335

 Score =  375 bits (962), Expect = e-108
 Identities = 187/312 (59%), Positives = 230/312 (73%), Gaps = 13/312 (4%)

Query: 1   MYYGLDIGGTKIELAIFDTQLALQDKWRLSTPGQDYSAFMATLAEQIEKADQQCGE---- 56
           M+YGLDIGGTKI LA+FD  +A  ++W++ TP  DY  F+  +  QIE+AD+   +    
Sbjct: 1   MHYGLDIGGTKIALALFDDSMACVERWQIPTPVADYGQFLDEVCAQIERADELAQQHSGV 60

Query: 57  --------RGTVGIALPGVVKADGTVISSNVPCLNQRRVAHDLAQLLNRTVAIGNDCRCF 108
                   +G+VGIALPGV+ +DGTV+SSNVPCLN R VA +L   L R VA+GNDCRCF
Sbjct: 61  TVQPAEVSKGSVGIALPGVILSDGTVLSSNVPCLNGRTVAQELTVRLGRPVALGNDCRCF 120

Query: 109 ALSEAVLGVGRGYSRVLGMILGTGTGGGLCIDGKLYLGANRLAGEFGHQGVSANVACRHQ 168
           ALSE +LG G G+ RVLG+ILGTG GGG+CI  KL LGA+ LAGEFGH G+ A+V  +HQ
Sbjct: 121 ALSEVLLGAGVGFERVLGVILGTGLGGGVCISQKLILGAHCLAGEFGHIGLPASVIIKHQ 180

Query: 169 LPLYVCGCGLEGCAETYVSGTGLGRLYQDIAGQTADTFAWLNALRCNDPLAIKTFDTYMD 228
           LPL+ CGCGL GCAETYVSGTGLGRLYQ   G TADT+ WL   R     AI TFD YMD
Sbjct: 181 LPLFECGCGLTGCAETYVSGTGLGRLYQHFGG-TADTYVWLADYRSGKAEAISTFDAYMD 239

Query: 229 ILGSLMASLVLAMDPDIIVLGGGLSEVEEILAALPQATKAHLFDGVTLPQFKLADFGSAS 288
            LGS++A  +L++DPD +V GGG+SEV+EI+AALP AT  HLF    LP+F++A+FG+AS
Sbjct: 240 ALGSVLAGQILSLDPDCLVFGGGISEVKEIIAALPDATARHLFASAKLPEFRVAEFGAAS 299

Query: 289 GVRGAALLGHGL 300
           GVRGAALLG  L
Sbjct: 300 GVRGAALLGKAL 311


Lambda     K      H
   0.321    0.140    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 402
Number of extensions: 21
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 308
Length of database: 335
Length adjustment: 28
Effective length of query: 280
Effective length of database: 307
Effective search space:    85960
Effective search space used:    85960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory