Align N-acetylglucosamine porter, NagP (characterized)
to candidate 6937025 Sama_1199 multiple antibiotic resistance (MarC)-related protein (RefSeq)
Query= TCDB::Q8EBL0 (435 letters) >FitnessBrowser__SB2B:6937025 Length = 438 Score = 415 bits (1066), Expect = e-120 Identities = 214/432 (49%), Positives = 290/432 (67%), Gaps = 10/432 (2%) Query: 6 SQQKSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTFTA 65 ++ S+ LPM ++ LFF+ GF TWLNG+L+P+LK +LN QA ++ F FYIA A Sbjct: 8 TKTSSTLLPMVLIGILFFVFGFVTWLNGALIPFLKIACELNELQAYMVTFVFYIAYFVMA 67 Query: 66 LPSAWVIRKVGYKNGMALGMGVMMIAGLLFIPAAKTQVFALFLFAQLVMGAGQTLLQTAV 125 LP + ++ + GY+ G+ +G+GVM + LLFIPAA + F LFL A V+G G T+LQTA Sbjct: 68 LPMSGLLSRFGYRAGLQIGLGVMALGALLFIPAAFSHTFGLFLLALFVLGTGLTILQTAA 127 Query: 126 NPYVVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLTQVQ----- 180 NPY+V +GP ESAA R+S MG++NKGAG++ PL+FSA +L + T L + Sbjct: 128 NPYIVVIGPSESAAMRISCMGVVNKGAGILVPLIFSAWVLTGTEAYTETALAALSEADKT 187 Query: 181 --IDEMANGLVLPYLGMAVFIGILALAVKKSPLPELSNEDEVADHTDKSQIKAALSHPNL 238 + ++ LV PYL MA + L V+ SPLPE + + + KS + L +P + Sbjct: 188 EALQALSARLVEPYLAMAAVLIALLFYVRFSPLPEPNLSAN--ESSQKSHWRELLKYPQV 245 Query: 239 ALGVLALFVYVAVEVIAGDTIGTFALSLGIDHYGVMTSYTMVCMVLGYILGILLIPRVIS 298 LG L LF+YV EVIAGD+IG + LG+ ++GV+TSYTM MVLGY++GI IPR IS Sbjct: 246 ILGALTLFLYVGAEVIAGDSIGLYGQHLGLSNFGVLTSYTMAFMVLGYLVGIATIPRFIS 305 Query: 299 QPTALMISAILGLLLTLGILFGDNNSYAIANLLLVPFGGVALPDTLLLIAFLGLANAIVW 358 Q TAL SAI GL+ TLGI+FGD +A+ LL PFG +P+T+L +A LG ANA+VW Sbjct: 306 QKTALACSAIAGLVFTLGIMFGDEQGTTLASWLLQPFGIAPVPNTVLCLALLGFANALVW 365 Query: 359 PAVWPLALSGMGKLTSTGSALLIMGIAGGAFGPVSWGLMSSATDMGQQGGYMVMLPCYLF 418 PAVWPLAL G+G+LT+T SALLIMGIAGGA P+++G + + + Q GY ++LPCY Sbjct: 366 PAVWPLALHGLGRLTATASALLIMGIAGGALLPLAYGALVQ-SGLSHQLGYGLLLPCYGM 424 Query: 419 ILFYAVKGHKMR 430 I FYAVKGH +R Sbjct: 425 IFFYAVKGHSLR 436 Lambda K H 0.326 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 706 Number of extensions: 35 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 435 Length of database: 438 Length adjustment: 32 Effective length of query: 403 Effective length of database: 406 Effective search space: 163618 Effective search space used: 163618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory