GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagP in Shewanella amazonensis SB2B

Align N-acetylglucosamine porter, NagP (characterized)
to candidate 6937025 Sama_1199 multiple antibiotic resistance (MarC)-related protein (RefSeq)

Query= TCDB::Q8EBL0
         (435 letters)



>lcl|FitnessBrowser__SB2B:6937025 Sama_1199 multiple antibiotic
           resistance (MarC)-related protein (RefSeq)
          Length = 438

 Score =  415 bits (1066), Expect = e-120
 Identities = 214/432 (49%), Positives = 290/432 (67%), Gaps = 10/432 (2%)

Query: 6   SQQKSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTFTA 65
           ++  S+ LPM ++  LFF+ GF TWLNG+L+P+LK   +LN  QA ++ F FYIA    A
Sbjct: 8   TKTSSTLLPMVLIGILFFVFGFVTWLNGALIPFLKIACELNELQAYMVTFVFYIAYFVMA 67

Query: 66  LPSAWVIRKVGYKNGMALGMGVMMIAGLLFIPAAKTQVFALFLFAQLVMGAGQTLLQTAV 125
           LP + ++ + GY+ G+ +G+GVM +  LLFIPAA +  F LFL A  V+G G T+LQTA 
Sbjct: 68  LPMSGLLSRFGYRAGLQIGLGVMALGALLFIPAAFSHTFGLFLLALFVLGTGLTILQTAA 127

Query: 126 NPYVVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLTQVQ----- 180
           NPY+V +GP ESAA R+S MG++NKGAG++ PL+FSA +L   +    T L  +      
Sbjct: 128 NPYIVVIGPSESAAMRISCMGVVNKGAGILVPLIFSAWVLTGTEAYTETALAALSEADKT 187

Query: 181 --IDEMANGLVLPYLGMAVFIGILALAVKKSPLPELSNEDEVADHTDKSQIKAALSHPNL 238
             +  ++  LV PYL MA  +  L   V+ SPLPE +      + + KS  +  L +P +
Sbjct: 188 EALQALSARLVEPYLAMAAVLIALLFYVRFSPLPEPNLSAN--ESSQKSHWRELLKYPQV 245

Query: 239 ALGVLALFVYVAVEVIAGDTIGTFALSLGIDHYGVMTSYTMVCMVLGYILGILLIPRVIS 298
            LG L LF+YV  EVIAGD+IG +   LG+ ++GV+TSYTM  MVLGY++GI  IPR IS
Sbjct: 246 ILGALTLFLYVGAEVIAGDSIGLYGQHLGLSNFGVLTSYTMAFMVLGYLVGIATIPRFIS 305

Query: 299 QPTALMISAILGLLLTLGILFGDNNSYAIANLLLVPFGGVALPDTLLLIAFLGLANAIVW 358
           Q TAL  SAI GL+ TLGI+FGD     +A+ LL PFG   +P+T+L +A LG ANA+VW
Sbjct: 306 QKTALACSAIAGLVFTLGIMFGDEQGTTLASWLLQPFGIAPVPNTVLCLALLGFANALVW 365

Query: 359 PAVWPLALSGMGKLTSTGSALLIMGIAGGAFGPVSWGLMSSATDMGQQGGYMVMLPCYLF 418
           PAVWPLAL G+G+LT+T SALLIMGIAGGA  P+++G +   + +  Q GY ++LPCY  
Sbjct: 366 PAVWPLALHGLGRLTATASALLIMGIAGGALLPLAYGALVQ-SGLSHQLGYGLLLPCYGM 424

Query: 419 ILFYAVKGHKMR 430
           I FYAVKGH +R
Sbjct: 425 IFFYAVKGHSLR 436


Lambda     K      H
   0.326    0.141    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 706
Number of extensions: 35
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 435
Length of database: 438
Length adjustment: 32
Effective length of query: 403
Effective length of database: 406
Effective search space:   163618
Effective search space used:   163618
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory