Align Acetate permease A; Monocarboxylate transporter acpA (characterized)
to candidate 6936507 Sama_0695 gpr1/fun34/YaaH family protein (RefSeq)
Query= SwissProt::Q5B2K4 (298 letters) >FitnessBrowser__SB2B:6936507 Length = 200 Score = 80.9 bits (198), Expect = 2e-20 Identities = 63/196 (32%), Positives = 92/196 (46%), Gaps = 20/196 (10%) Query: 83 ANPAPLGLSAFALTTFVLSCINMGARDITHPNIVIALAFGYGGLVQLLAGMWEMAVGNTF 142 ANPAPLGL F +TT +L+ N G I +++A+ YGGL Q++ G+ G+TF Sbjct: 6 ANPAPLGLMGFGMTTILLNIHNAGFFPIDA--MILAMGIFYGGLGQVIVGIMCFMRGDTF 63 Query: 143 GATALSSYGGFWIAF-AIVLTPGGFNIQTALTAENGDEAMFYNSFGLFLMGWFIFTTIML 201 G TA +SYG FW+ ++L P G A + G +L W +FT M Sbjct: 64 GTTAFTSYGLFWLTLVGLILMPNA-----------GVAASPASFMGWYLALWGVFTGFMF 112 Query: 202 FCTLRSTVAFFLLFLFLDLAFLLLGVGYIQRDDAGQPNPPVIKAGGFFGLLAAFAAWYNA 261 +LR +F L L F LL RD G I A + G++ +A Y A Sbjct: 113 IGSLRYARIKQFIFGSLTLLFFLLAA----RDFTGSELIGTIAA--WEGIICGASAIYFA 166 Query: 262 LAGIADSSNSFFIIPV 277 +A + + ++PV Sbjct: 167 MAQVINGEYGRTVLPV 182 Lambda K H 0.324 0.139 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 200 Length adjustment: 24 Effective length of query: 274 Effective length of database: 176 Effective search space: 48224 Effective search space used: 48224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory