Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate 6938665 Sama_2768 proton/glutamate symporter (RefSeq)
Query= TCDB::Q848I3 (444 letters) >FitnessBrowser__SB2B:6938665 Length = 430 Score = 255 bits (652), Expect = 2e-72 Identities = 140/421 (33%), Positives = 238/421 (56%), Gaps = 11/421 (2%) Query: 11 LYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSGIAGMQNMK 70 L+ Q++ + +GI +G ALKP+G F+ IKM+I P++FC+++ G+ MQ+ Sbjct: 18 LWLQILTGMLLGIGVGLVLGPDASALKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMQDTA 77 Query: 71 SVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAAYVTAGKDQS 130 +G+ G + ++ + IA+ +GL+V +++PG G+ ++ L A A S Sbjct: 78 RMGRIGFKSFAFYLATTAIAISVGLMVGWLLEPGAGLSLEGHDLSAEVKTA-------PS 130 Query: 131 IVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDRFAHVMFNI 190 ++ ++N++P V A A+G ILQV++F+V G AL +G +GKP + + A M+ + Sbjct: 131 VMDTLINIVPTNPVAALASGQILQVIVFAVALGVALVLIGDHGKPAIKVFESLAEAMYKL 190 Query: 191 INMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVLVVLGAICR-AHGF 249 +M+MKLAP G G MA+ G YG+ L+ L +++I Y+ C L +L + + G Sbjct: 191 TDMVMKLAPYGVFGLMAWVAGEYGIDMLLPLIKVIIAVYLGCALHILGFYSLVLKLVAGL 250 Query: 250 SVLKLIRYIREELLIVLGTSSSESALP-RMLIKMERLGAKKSVVGLVIPTGYSFNLDGTS 308 S ++ + I + + TSSS LP M E LG K + V+P G + N+DGT+ Sbjct: 251 SPIQFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTA 310 Query: 309 IYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSAVGHLPV 368 +Y + A+F+AQA + +T++L L+S G AGV G+G ++L L+ VG LP+ Sbjct: 311 LYQGVTALFVAQAFGVDLTWVDYLTIVLTATLASIGTAGVPGAGLVMLTLVLTTVG-LPL 369 Query: 369 AGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDQLQAELASGGRAISDTRE 428 G+A+I GIDR + AR + N+ G+ VAT V+A+ E+D A++ + ++ RE Sbjct: 370 EGVAIIAGIDRILDMARTVVNVSGDLVATTVIARSEGEIDIAHYNADMETSSE-MAQARE 428 Query: 429 E 429 + Sbjct: 429 D 429 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 430 Length adjustment: 32 Effective length of query: 412 Effective length of database: 398 Effective search space: 163976 Effective search space used: 163976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory