Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate 6936328 Sama_0517 D-beta-hydroxybutyrate dehydrogenase (RefSeq)
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >FitnessBrowser__SB2B:6936328 Length = 266 Score = 115 bits (287), Expect = 1e-30 Identities = 82/268 (30%), Positives = 123/268 (45%), Gaps = 27/268 (10%) Query: 16 GER-LKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEK-----VETVAAHWRERG 69 G+R L+ KV L+TG+ GIG A A Q L++ + E AA +R R Sbjct: 4 GQRSLEGKVGLITGSTSGIGLATAQVLAEQGCNLILHGLLPEDEGQSMAADFAAQYRIR- 62 Query: 70 ADVHALKADVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAID 129 AD+ + +H + G ID+L+N AG+ E W AI+ Sbjct: 63 --TFFSNADLRQPESIHRFMAEGTKALGSIDILINNAGIQHTDSVASFPIEKWNDIIAIN 120 Query: 130 LDGAWYGCKAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYA 189 L A++ + +P M ++ G IINIAS H Y AKHG++GLT+ + IE A Sbjct: 121 LSSAFHTMQQAVPAMAQKRWGRIINIASVHGLVASVNKAAYCAAKHGIVGLTKVVAIECA 180 Query: 190 PKGVRVNAIAPGYIETQL------------NVDYWNGFADPYAERQRALDLHPPRRIGQP 237 +G+ VNAI PG+++T L +DY +Q ++ PR+IG+ Sbjct: 181 EQGITVNAICPGWVDTPLINKQIEAVANTKGLDYHEARYQLVTAKQPLPEMLDPRQIGE- 239 Query: 238 IEVAMTAVFLASDEAPFINASCITIDGG 265 A+FL D A I + + +DGG Sbjct: 240 -----FALFLCGDAARGITGASLAMDGG 262 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 266 Length adjustment: 25 Effective length of query: 247 Effective length of database: 241 Effective search space: 59527 Effective search space used: 59527 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory