Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate 6938129 Sama_2250 acetoacetyl-CoA reductase (RefSeq)
Query= reanno::ANA3:7024897 (256 letters) >FitnessBrowser__SB2B:6938129 Length = 243 Score = 90.1 bits (222), Expect = 4e-23 Identities = 51/160 (31%), Positives = 83/160 (51%), Gaps = 2/160 (1%) Query: 95 LINNAACDQRHSIDEVTPEYWDQCLNTNLRHYFFAVQAVRPQMQRLGGGSVINLGSMSWH 154 L+NN + S ++T E W Q ++ NL F Q + M G G ++N+ S++ H Sbjct: 82 LVNNLGITRDSSFKKMTSEQWKQVMDVNLFSVFSLTQCIFNHMALSGSGRIVNISSVNAH 141 Query: 155 NRQAGMAGYTASKAGAMGLTRGLAADLGKDKIRINTLTPGWVMTKRQLTHWVDKDTAKHI 214 Q G Y A+KAG +G T+ L+ + K I +N+++PG+ TK L+H + D + I Sbjct: 142 RGQFGQVNYCAAKAGLLGFTKALSLEGAKSGITVNSVSPGYTDTK-MLSH-IPTDILQSI 199 Query: 215 ENNQCIKEYVMPEDIAAMALFLAADDSKLCTAQNFIVDGG 254 +++ +K P +IA FL D S T + V+GG Sbjct: 200 KDSVPMKRLAKPIEIAHAVAFLLDDKSAYITGADIPVNGG 239 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 243 Length adjustment: 24 Effective length of query: 232 Effective length of database: 219 Effective search space: 50808 Effective search space used: 50808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory