Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate 6938538 Sama_2641 polyamine ABC transporter, ATP-binding protein (RefSeq)
Query= uniprot:P0DTT6 (251 letters) >FitnessBrowser__SB2B:6938538 Length = 378 Score = 115 bits (288), Expect = 1e-30 Identities = 72/217 (33%), Positives = 121/217 (55%), Gaps = 8/217 (3%) Query: 4 LLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVF 63 LL+I V K F V+A+D VS+ INKGE+ ALLG +G+GKSTL+++++G+ +P G + Sbjct: 20 LLKIERVSKLFDDVRAVDDVSLTINKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIYL 79 Query: 64 EGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKKMMEESKK 123 +G+ + P + I ++Q AL P + + NI + + + ++E K Sbjct: 80 DGQDITDLPPYER---PINMMFQSYALFPHMTVEQNIAFGLKQDKMSKADISQRVQEMLK 136 Query: 124 LLDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAAL-SVVEARKVLE 182 L+ Q K LSGGQRQ VA+AR++ K++L+DEP AL + + LE Sbjct: 137 LVHMEQY----AKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRTQMQLE 192 Query: 183 LARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKI 219 + L++ G+ +++TH+ + +A RI ++ G I Sbjct: 193 VVEILERVGVTCVMVTHDQEEAMTMAGRIAIMSDGWI 229 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 378 Length adjustment: 27 Effective length of query: 224 Effective length of database: 351 Effective search space: 78624 Effective search space used: 78624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory