Align agmatine deiminase (EC 3.5.3.12) (characterized)
to candidate 6938402 Sama_2521 agmatine deiminase (RefSeq)
Query= BRENDA::Q9I6J9 (368 letters) >FitnessBrowser__SB2B:6938402 Length = 375 Score = 432 bits (1110), Expect = e-126 Identities = 211/359 (58%), Positives = 257/359 (71%), Gaps = 3/359 (0%) Query: 6 STPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQAAFAAVAKAIARFEPVTVCAS 65 STP ADGF MPAEW + WM+WP RPDNWR G+ AQA FA VA AI PV + Sbjct: 18 STPAADGFTMPAEWAHQQAVWMIWPYRPDNWREAGRFAQATFAKVADAIGGATPVFMGVP 77 Query: 66 AGQYENARARLDDGNIRVVEISSDDAWVRDTGPTFVIDDKGDVRGVDWGFNAWGGFEGGL 125 A + ARA + ++ +VE++SDD W RDTGPT V + G+ RG+DWGFNAWGG +GGL Sbjct: 78 AEFMDKARAIMP-AHVTLVEMNSDDCWARDTGPTVVTNGAGECRGIDWGFNAWGGHKGGL 136 Query: 126 YFPWQRDDQVARKILEIERRARYRTDDFVLEGGSIHVDGEGTLITTEECLLNHNRNPHLS 185 YFPW +D++VA ++L RY +LEGGSIHVDGEGT +TT ECLLN NRNPHL+ Sbjct: 137 YFPWDQDEKVAAQMLAQHGMDRYAAP-LILEGGSIHVDGEGTCMTTAECLLNENRNPHLT 195 Query: 186 QAEIERTLRDYLAVESIIWLPNGLYNDETDGHVDNFCCYARPGEVLLAWTDDQDDPNYLR 245 + +IE LRDYL V S IWL +G+Y DETDGH+DN CC+ RPGEV L WTDD +DP Y R Sbjct: 196 KEQIEAHLRDYLGVTSFIWLGDGVYMDETDGHIDNICCFVRPGEVALHWTDDVNDPQYER 255 Query: 246 CQAALRVLEESRDAKGRKLVVHKMPIPGPLYATQEECDGVDIVEGSQPRDPSIRLAGSYV 305 AAL++LE + DAKGRKL V K+P PGPLY T+EE GV+ G PR+ RLAGSYV Sbjct: 256 SVAALKLLEAAVDAKGRKLKVWKLPQPGPLYCTEEESAGVESGTG-VPREAEGRLAGSYV 314 Query: 306 NFLIVNGGIIAPSFDDPKDAEARAILQRVFPEHEVVMVPGREILLGGGNIHCITQQQPA 364 NFLI N I+ P D+ D EA+ IL+ +FPE++V+ VP REILLGGGNIHCITQQ P+ Sbjct: 315 NFLITNDRIVYPLLDEATDGEAQRILEDIFPEYQVIGVPAREILLGGGNIHCITQQIPS 373 Lambda K H 0.319 0.138 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 375 Length adjustment: 30 Effective length of query: 338 Effective length of database: 345 Effective search space: 116610 Effective search space used: 116610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 6938402 Sama_2521 (agmatine deiminase (RefSeq))
to HMM TIGR03380 (aguA: agmatine deiminase (EC 3.5.3.12))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03380.hmm # target sequence database: /tmp/gapView.27048.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03380 [M=357] Accession: TIGR03380 Description: agmatine_aguA: agmatine deiminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-175 568.8 0.0 2.5e-175 568.6 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6938402 Sama_2521 agmatine deiminase (Re Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6938402 Sama_2521 agmatine deiminase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 568.6 0.0 2.5e-175 2.5e-175 1 356 [. 18 372 .. 18 373 .. 1.00 Alignments for each domain: == domain 1 score: 568.6 bits; conditional E-value: 2.5e-175 TIGR03380 1 ttpkedgfrlPaefekqkevwliWPerpDnWregakpaqkafaevakaiakvepvtvlvskeqyenarkalpeeirv 77 +tp++dgf +Pae+++q++vw+iWP+rpDnWre+++ aq++fa+va+ai ++pv++ v++e++++ar+ +p+++++ lcl|FitnessBrowser__SB2B:6938402 18 STPAADGFTMPAEWAHQQAVWMIWPYRPDNWREAGRFAQATFAKVADAIGGATPVFMGVPAEFMDKARAIMPAHVTL 94 58*************************************************************************** PP TIGR03380 78 vemssnDawirDvGPtfvvndkgelrgvdwefnawgglkdGlyfpWdkDdkvarkvleleridryradlvleggsih 154 vem+s+D+w rD+GPt+v+n +ge+rg+dw fnawgg+k+GlyfpWd+D+kva ++l+ +++dry a+l+leggsih lcl|FitnessBrowser__SB2B:6938402 95 VEMNSDDCWARDTGPTVVTNGAGECRGIDWGFNAWGGHKGGLYFPWDQDEKVAAQMLAQHGMDRYAAPLILEGGSIH 171 ***************************************************************************** PP TIGR03380 155 vDGeGtlltteeclLsegrnpelskeeieeklkeylgvekviWlkeGlyldetnGhvDnllnfvrPGevvlswtdde 231 vDGeGt++tt+eclL+e+rnp+l+ke+ie++l++ylgv+++iWl +G+y+det+Gh+Dn+++fvrPGev+l+wtdd lcl|FitnessBrowser__SB2B:6938402 172 VDGEGTCMTTAECLLNENRNPHLTKEQIEAHLRDYLGVTSFIWLGDGVYMDETDGHIDNICCFVRPGEVALHWTDDV 248 ***************************************************************************** PP TIGR03380 232 sdPqyeiskealevLenetDakGrklkvhklklpeplllteeeakgvdavegtlpreagerlaasyvnyliankaii 308 +dPqye+s +al++Le+++DakGrklkv+kl++p+pl++teee++gv++ +g +prea+ rla+syvn+li+n++i+ lcl|FitnessBrowser__SB2B:6938402 249 NDPQYERSVAALKLLEAAVDAKGRKLKVWKLPQPGPLYCTEEESAGVESGTG-VPREAEGRLAGSYVNFLITNDRIV 324 ***************************************************9.************************ PP TIGR03380 309 lPlfddekDkeakkllqelfPdrkvvgvkareillgGGnihcitqqip 356 +Pl+d+++D ea+++l+++fP+++v+gv+areillgGGnihcitqqip lcl|FitnessBrowser__SB2B:6938402 325 YPLLDEATDGEAQRILEDIFPEYQVIGVPAREILLGGGNIHCITQQIP 372 **********************************************99 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (357 nodes) Target sequences: 1 (375 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.64 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory