Align crotonase (EC 4.2.1.150) (characterized)
to candidate 6935814 Sama_0032 multifunctional fatty acid oxidation complex subunit alpha (RefSeq)
Query= metacyc::MONOMER-13469 (259 letters) >FitnessBrowser__SB2B:6935814 Length = 716 Score = 140 bits (353), Expect = 7e-38 Identities = 79/184 (42%), Positives = 108/184 (58%), Gaps = 6/184 (3%) Query: 14 VASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGSGKAFVAGADIAEMKDL 73 +A + N P ++N + TL ++AA+ D+ +D + A ++T F+ GADI E L Sbjct: 17 IARLCFNAPGSVNKFDRETLASLNAAL-DVLKDSDAKAAVLTSGKDTFIVGADITEFLAL 75 Query: 74 TAVEGRKFS---VLGNKIFRKLENLEKPVIAAINGFALGGGCELSLSCDIRIASSKAKFG 130 A E K N +F KLE+L P ++AI GFALGGGCE L+ D R+A + AK G Sbjct: 76 FAEEDAKLMEWIAQANVVFNKLEDLPFPTVSAIKGFALGGGCEAILATDFRVADTSAKIG 135 Query: 131 QPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVNKVVEPDKLLEE 190 PE LG+ PGFGGT RL R IG A E I TGK E+AL++G ++ VV P+ L E Sbjct: 136 LPETKLGLIPGFGGTVRLPRLIGADNALEWITTGKDQRPEDALKVGAIDAVVAPENL--E 193 Query: 191 AKAL 194 A A+ Sbjct: 194 AAAI 197 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 716 Length adjustment: 32 Effective length of query: 227 Effective length of database: 684 Effective search space: 155268 Effective search space used: 155268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory