Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate 6939206 Sama_3300 acyl-CoA transferase/carnitine dehydratase (RefSeq)
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >FitnessBrowser__SB2B:6939206 Length = 389 Score = 426 bits (1095), Expect = e-124 Identities = 220/390 (56%), Positives = 272/390 (69%), Gaps = 6/390 (1%) Query: 4 LSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENTTEA 63 L LRVLDLSRVLAGPW Q+LAD+GA+VIK+E P GDDTR WGPP+ A G +A Sbjct: 5 LKGLRVLDLSRVLAGPWCSQLLADMGAEVIKIEHPDGGDDTRHWGPPY---AGGHTQGDA 61 Query: 64 AYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKAINP 123 AY+L+ANR K+S+ +D P +++LA SDIL+ENFKVGGLA YGLDY SLKA+NP Sbjct: 62 AYFLAANRGKKSLLLDLKNPHDVAQIQKLARHSDILLENFKVGGLAKYGLDYGSLKAMNP 121 Query: 124 QLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDILTG 183 QL+YCSITGFGQ+GP A RAGYDFMIQ +GGLMSLTG D+G P+K GVA+TD+ TG Sbjct: 122 QLVYCSITGFGQSGPDAPRAGYDFMIQAMGGLMSLTGA--ADDGGEPMKTGVAITDLFTG 179 Query: 184 LYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHPNIV 243 LY+ AILAA+ R G G HIDMAL DVQ+A LANQA N+L +G P RLGNAHPNIV Sbjct: 180 LYAANAILAAIVARQSTGLGCHIDMALFDVQLAMLANQAQNFLASGQNPPRLGNAHPNIV 239 Query: 244 PYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLIRQA 303 PYQ F ADG IL VGNDGQF +F E+AG + D RFATN RV +R L+PLI+ A Sbjct: 240 PYQAFACADGHLILAVGNDGQFARFCELAGLHELPHDSRFATNAGRVRHRETLLPLIKAA 299 Query: 304 TVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVASPIR 363 + K+ EW+ L AGVP GPIN +++ +PQ Q R + +E ++P V SP++ Sbjct: 300 MLTKSKGEWLALLNDAGVPAGPINTVSEALDEPQAQHRQMQIE-RDFNGERLPFVGSPVK 358 Query: 364 LSETPVEYRNAPPLLGEHTLEVLQRVLGLD 393 + + PP LGEH E+L + GL+ Sbjct: 359 MDGEALNSPLPPPRLGEHQQELLAWLDGLE 388 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 389 Length adjustment: 31 Effective length of query: 375 Effective length of database: 358 Effective search space: 134250 Effective search space used: 134250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory