GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puuB in Shewanella amazonensis SB2B

Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate 6938544 Sama_2647 oxidoreductase (RefSeq)

Query= reanno::pseudo5_N2C3_1:AO356_21495
         (427 letters)



>lcl|FitnessBrowser__SB2B:6938544 Sama_2647 oxidoreductase (RefSeq)
          Length = 435

 Score =  357 bits (916), Expect = e-103
 Identities = 178/422 (42%), Positives = 263/422 (62%), Gaps = 4/422 (0%)

Query: 6   YPESYYAASANPVPPRPALQDDVETDVCVIGAGYTGLSSALFLLENGFKVTVLEAAKVGF 65
           YP+S+Y A+A  +   P L   +E DVCV+G G++GL++A+ L + GF V +LEA +VG+
Sbjct: 12  YPDSFYFATAKELFQYPVLDSAIEVDVCVVGGGFSGLNTAIELRQKGFNVALLEAKRVGW 71

Query: 66  GASGRNGGQIVNSYSRDIDVIERSVGPQQAQLLGNMAFEGGRIIRERVAKYQIQCDLKDG 125
           GASGRNGG+++      ++    ++G +    +  M FE   I+R+R+A + I CDL  G
Sbjct: 72  GASGRNGGELIRGIGHGLEQFHNTIGQEGIDAITQMGFEAVEIVRKRIADHNIDCDLAMG 131

Query: 126 GVFAALTAKQMGHLESQKRLWERFGHTQ-LELLDQRRIREVVACEEYVGGMLDMSGGHIH 184
               A+  + M  L  +    +  G+ Q ++LL +  + +V+  + Y G ++DM  GH+H
Sbjct: 132 YCDLAVKPRHMAELAEEFEHLKTAGYRQDIKLLQKADLCDVIGSDCYQGALVDMGSGHLH 191

Query: 185 PLNLALGEAAAVESLGGVIYEQSPAVRIERGASPVVHTPQGKVRAKFIIVAGNAYLGN-L 243
           PLNLALGEA     LG  I+E S A  I +G  P V T +G+V  +++++AGNAY+G+ L
Sbjct: 192 PLNLALGEARVARELGVQIFEYSAATNIIKGDKPRVITEKGEVNCRYLVLAGNAYIGHKL 251

Query: 244 VPELAAKSMPCGTQVIATEPLGDELAHSLLPQDYCVEDCNYLLDYYRLTGDKRLIFGGGV 303
            P +  K +P G+ ++ATEPL  EL   ++PQ+    D    LDY+ L+ D RL+FGG  
Sbjct: 252 EPYVGGKVLPAGSYLLATEPLSPELQREIIPQNMAFADMRIALDYFHLSADGRLLFGGLC 311

Query: 304 VYGARDPANIEAIIRPKMLKAFPQLKDVKIDYAWTGNFLLTLSRLPQVGRLGD--NIYYS 361
            Y  +DP++IEA +RP + + FP+LK V+IDY W G   +  +RLPQ+GRL D  NI+++
Sbjct: 312 TYSGKDPSDIEAALRPNLERVFPKLKGVRIDYQWGGMIGIGANRLPQLGRLPDAPNIFFA 371

Query: 362 QGCSGHGVTYTHLAGKVLAEALRGQAERFDAFADLPHYPFPGGQLLRTPFAAMGAWYYGL 421
           Q  SGHGV  TH+  K+LAEA+ GQAERFD FA + H  FPGG  LR+P  A G  Y+  
Sbjct: 372 QAYSGHGVNATHMMAKLLAEAIAGQAERFDVFAKVKHMTFPGGPALRSPLLAAGMLYHRF 431

Query: 422 RD 423
            D
Sbjct: 432 MD 433


Lambda     K      H
   0.320    0.139    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 565
Number of extensions: 29
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 427
Length of database: 435
Length adjustment: 32
Effective length of query: 395
Effective length of database: 403
Effective search space:   159185
Effective search space used:   159185
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory