Align beta-aspartyl-peptidase (EC 3.4.19.5); asparaginase (EC 3.5.1.1) (characterized)
to candidate 6937461 Sama_1617 asparaginase family protein (RefSeq)
Query= BRENDA::P37595 (321 letters) >FitnessBrowser__SB2B:6937461 Length = 327 Score = 310 bits (793), Expect = 4e-89 Identities = 168/315 (53%), Positives = 208/315 (66%), Gaps = 6/315 (1%) Query: 6 IAIHGGAGAISRAQMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLLEECPL 65 IAIHGGAG IS+A+++ +QE Y + L V G K+L G +LD V A+ +LE+ PL Sbjct: 13 IAIHGGAGTISKARLTDEQEQAYRDKLEEAVNAGHKILAKGGDSLDAVKAAINILEDSPL 72 Query: 66 FNAGIGAVFTRDETHELDACVMDGNTLKAGAVAGVSHLRNPVLAARLVMEQSPHVMMIGE 125 FNAG+GAV+T D THELDA +MDGNT+ AGAVAGV H++NP+ A +VM +S HVM+ G Sbjct: 73 FNAGMGAVYTFDGTHELDASIMDGNTMNAGAVAGVKHIKNPIDLALVVMNKSDHVMLSGV 132 Query: 126 GAENFAFARGMERVSPEIFSTSLRYEQLLAAR------KEGATVLDHSGAPLDEKQKMGT 179 GAE FA +GM V F T RY+QLL A+ + A S LD K GT Sbjct: 133 GAEEFALTQGMPLVPANTFDTDSRYQQLLDAKAKINAAESAAKDFHASATSLDLDYKFGT 192 Query: 180 VGAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRA 239 VGAVALD +GNLAA TSTGGMT K GR+GDSP++GAG YA N AVS TG GE FIR Sbjct: 193 VGAVALDKNGNLAAGTSTGGMTAKRFGRIGDSPVIGAGTYAENGVCAVSATGHGEYFIRY 252 Query: 240 LAAYDIAALMDYGGLSLAEACERVVMEKLPALGGSGGLIAIDHEGNVALPFNTEGMYRAW 299 A DI A M Y ++ +A + V+ ++L GGSGG+IAID +GNVA PFNTEGMYRA Sbjct: 253 HVAADICARMKYQQKNVIQASDEVINQRLVEAGGSGGIIAIDAQGNVATPFNTEGMYRAS 312 Query: 300 GYAGDTPTTGIYREK 314 D P I+R+K Sbjct: 313 RVNKDAPLIMIWRDK 327 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 327 Length adjustment: 28 Effective length of query: 293 Effective length of database: 299 Effective search space: 87607 Effective search space used: 87607 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory