Align CAC0385 (EC 3.2.1.86) (characterized)
to candidate 6937232 Sama_1402 Beta-glucosidase (RefSeq)
Query= CAZy::AAK78365.1 (469 letters) >FitnessBrowser__SB2B:6937232 Length = 452 Score = 288 bits (736), Expect = 3e-82 Identities = 158/439 (35%), Positives = 245/439 (55%), Gaps = 31/439 (7%) Query: 5 KDFFLGAASASYQVEGAWNEDGKGVSNWDVFTKIPGKTFEGTNGDVAVDHYHRYKEDVKL 64 KDF G A+AS+Q+EG + + + WD F PGK +G+NG VA DH +++DV L Sbjct: 18 KDFLFGVATASFQIEG--DAEHRQPCIWDTFCDTPGKIADGSNGQVACDHVKLWRDDVDL 75 Query: 65 MAEMGLDSYRFSVSWPRIIPDGDGEINQKGIEFYNNLIDECLKYGIVPFVTLYHWDMPEV 124 +A +G+D+YR S+SW R++ DG +NQ+G++FY NL+DE + GI FVTLYHWD+P+ Sbjct: 76 IASLGVDAYRLSISWGRVLHP-DGSVNQRGMDFYINLLDELGRRGINVFVTLYHWDLPQH 134 Query: 125 LEKAGGWTNKKTVDAFVKYAKACFEAFGDRVKRWITFNETIVFCSNGYLSGAHPPGITGD 184 LE GGW N+ T AF YA A G+RV + T NE GY +G H PG Sbjct: 135 LEDKGGWLNRDTAVAFANYAAIVANALGNRVYAYSTLNEPFCSAFLGYEAGIHAPGHKSR 194 Query: 185 VKKYFQATHNVFTAHARSVIEYKKLKQYGEIGITHVFSPAFSVDDKEENKAAAYHANQYE 244 ++ A HN+ AH ++ E ++ + GI FSPA+ + AA A++Y Sbjct: 195 -QQGRTAAHNLLLAHGMAMTEIRREAPEAKAGIVLNFSPAYPYTSSAGDANAARLAHEYH 253 Query: 245 ITWYYDPILKGKYPEYVIKNIEKQGFLPDWTDEELNTLREAAPLNDFIGLNYYQPQRVIK 304 TWY P+++G+YP+ +I +E P +++ + + P+ D++G+NYY Sbjct: 254 NTWYLMPLMEGRYPD-IINQLEPHE-RPVVEPGDMDII--STPI-DYLGINYY------- 301 Query: 305 NHDTGEKIERTRENSTGAPGNASFDGFYRTVKMDDKTYTKWGWEISPESLILGLEKLKEQ 364 N A G F+ V++D+ T WEI P++ L L ++ Sbjct: 302 -----------TRNVYRAGGPLGFE----EVRIDNVPRTAMDWEICPQAFTDLLTGLAQE 346 Query: 365 YGDIKIYITENGLGDQDPIIEDEILDMPRIKFIEAHLRAIKEAISRGINLKGYYAWSVID 424 + IYITENG + D + D R+ ++++HL A+ +AI RG+++KGY+AWS++D Sbjct: 347 FNLPPIYITENGAAEDDAPFNGTVHDPMRLDYLQSHLLAVHQAIERGVDIKGYFAWSLMD 406 Query: 425 LLSWLNGYKKQYGFIYVDH 443 W GY+K++G +YVD+ Sbjct: 407 NFEWAEGYRKRFGLVYVDY 425 Lambda K H 0.318 0.138 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 633 Number of extensions: 33 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 452 Length adjustment: 33 Effective length of query: 436 Effective length of database: 419 Effective search space: 182684 Effective search space used: 182684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory