Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate 6936572 Sama_0760 iron-compound ABC transporter, ATP-binding protein, putative (RefSeq)
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__SB2B:6936572 Length = 271 Score = 156 bits (395), Expect = 4e-43 Identities = 84/249 (33%), Positives = 136/249 (54%), Gaps = 3/249 (1%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 + NL +L+ VS +L + +IGPNG GKS+LL C R + P SGT+ L Sbjct: 5 IEVSNLCWRVAERPLLDGVSFALSGNGMYGVIGPNGAGKSSLLRCLYRFIRPDSGTILLN 64 Query: 63 DNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVA 122 I++ S R AR ++++PQ ++ + +V+ G P SA D + A Sbjct: 65 GQDIHLYSRRSFARAVAVVPQELPALFDLSTEAVVAMGLIPHKGWLAADSAADKVNIAAA 124 Query: 123 MNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMG 182 + + + + +LSGG++QRA +A L Q ++LDEPT++LD+ Q++++ L+ Sbjct: 125 LAEVGLEGYGRQPFGKLSGGEKQRALIARALVQKPQFLILDEPTSHLDVRFQIEVLELLK 184 Query: 183 ELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEIH 242 L V+ +HDLN AS CD+L++M+ G + A G+P EV+T +L +VF V + Sbjct: 185 RLDI---CVICTIHDLNLASALCDELLLMSRGRLEASGSPAEVLTETMLASVFGVCTTVK 241 Query: 243 PEPVSGRPM 251 P P GRP+ Sbjct: 242 PHPQHGRPL 250 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 271 Length adjustment: 25 Effective length of query: 230 Effective length of database: 246 Effective search space: 56580 Effective search space used: 56580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory