Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate 6937163 Sama_1333 lipoprotein releasing system ATP-binding protein LolD (RefSeq)
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >FitnessBrowser__SB2B:6937163 Length = 229 Score = 133 bits (334), Expect = 4e-36 Identities = 86/221 (38%), Positives = 125/221 (56%), Gaps = 15/221 (6%) Query: 4 LEVQDLHKRYGSH----EVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGK 59 L+V+++ K Y +VL GV L G+ ++I+G SGSGKST L + L++P +GK Sbjct: 6 LKVENVSKTYREGKLETQVLCGVDLSVYRGEQLAIVGGSGSGKSTLLHIMGSLDKPTSGK 65 Query: 60 ILLNNEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVL 119 +LL E+L +L AA +Q Q + L ++Q +L +A+EN+ P + Sbjct: 66 VLLEGEDLY-------SLSAA--RQAQIRNASLGFIYQFHHLLPEFSALENVA-MPARIA 115 Query: 120 GMSKAEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSA 179 G+ K A +AE L +VG+SHR P +SGGE+QRVAIARAL +P ++L DEPT Sbjct: 116 GVDKKTAFGRAEALLERVGLSHRLSHAPSELSGGERQRVAIARALINQPRLVLADEPTGN 175 Query: 180 LDPELVGDVLKVMQAL-AQEGRTMVVVTHEMGFAREVSNQL 219 LD V +++ L AQ G VVVTH+ A + QL Sbjct: 176 LDAASGEAVYALIRELAAQLGTAFVVVTHDNALAARMDRQL 216 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 229 Length adjustment: 23 Effective length of query: 231 Effective length of database: 206 Effective search space: 47586 Effective search space used: 47586 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory