Align arginine N-succinyltransferase; EC 2.3.1.109 (characterized)
to candidate 6937471 Sama_1627 arginine N-succinyltransferase (RefSeq)
Query= CharProtDB::CH_107315 (338 letters) >FitnessBrowser__SB2B:6937471 Length = 348 Score = 234 bits (597), Expect = 2e-66 Identities = 131/340 (38%), Positives = 193/340 (56%), Gaps = 7/340 (2%) Query: 1 MLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYF 60 ML++RP Q +D + +A +S G TSLP +L KI SE SFAA++ G++ Y Sbjct: 1 MLLIRPIQGSDFQALMTMARESGAGFTSLPLCERKLTHKIAHSEESFAADIDAPGDQGYL 60 Query: 61 FVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGN 120 FVLED+ +GE++G S I AS G P Y F T VH + L I N + VL+L +D TG Sbjct: 61 FVLEDTDTGEILGASGIEASVGLGSPLYHFHKSTVVHQCKELDIFNPVEVLTLGNDYTGV 120 Query: 121 SLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAV 180 + + + +++ + S+ R +FMA HP+RF+ V+ E+ G +DE G+ PFW + Sbjct: 121 TEICTLFLREPYRVGLNGRFLSKVRFMFMAEHPKRFSQLVIAEMRGAADENGQPPFWGWL 180 Query: 181 GRNFFDLNYIEAEKLSGLKSRTFLAELMPHYPIYVPLLPDAAQESMGQVHPRAQITFDIL 240 FF++ + +A+ L G+ ++ F+A+LMP YPIYV LLP+AA+ ++GQVH +L Sbjct: 181 RETFFNMEFSKADYLIGVGNKGFIADLMPRYPIYVDLLPEAARNTIGQVHENTVPALKLL 240 Query: 241 MREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEAP---KSGRPYLVTNGQL 297 EGF Y+D+FD GPT+ A+ I+S+ QS V V I + P K V N Sbjct: 241 ENEGFMHRGYVDLFDAGPTVEAQLKQIKSVRQSHRVKVVISQNPAEHKGEFHLAVCNCDS 300 Query: 298 QDFRAVVLD---LDWAPGKPVALSVEAAEALGVGEGASVR 334 + FRA V D L+ + +S A+ L V EG VR Sbjct: 301 KAFRATVSDECRLE-PETHSILMSPAMADVLNVAEGDLVR 339 Lambda K H 0.319 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 348 Length adjustment: 29 Effective length of query: 309 Effective length of database: 319 Effective search space: 98571 Effective search space used: 98571 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory