Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate 6938533 Sama_2636 4-aminobutyrate aminotransferase (RefSeq)
Query= BRENDA::P42588 (459 letters) >FitnessBrowser__SB2B:6938533 Length = 425 Score = 188 bits (477), Expect = 3e-52 Identities = 143/417 (34%), Positives = 208/417 (49%), Gaps = 36/417 (8%) Query: 47 NPGFLEYRKSVTAGG--DYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVV 104 N + R++ AGG V + T+ D +G+E+ID GG + N GH +P V Sbjct: 5 NDSLMVRRRAAVAGGVGQIHPVFTERAENATVWDVEGREYIDFAGGIAVLNTGHLHPKVK 64 Query: 105 SAVQNQLAKQPLHSQELLDPLRAMLA--KTLAALTPGKL-KYSFFCNSGTESVEAALKLA 161 +AV QL K H+ ++ + +A + L L PG K S SG+E+VE A+K+A Sbjct: 65 AAVAEQLEKFS-HTCFMVLGYESYVAVCEKLNQLVPGDFAKKSALFTSGSEAVENAIKVA 123 Query: 162 KAYQSPRGKFTFIATSGAFHGKSLGALSATAK-------------STFRKPFMPLLPGFR 208 +AY G F TSG +HG+++ AL+ T K + FR F L G Sbjct: 124 RAYTKRAGVIAF--TSG-YHGRTMAALALTGKVAPYSKGMGLMQANVFRAEFPCALHGVS 180 Query: 209 HVP-FGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGAL 267 +IE R N+ + + D+AA+ILEP+QGEGG PG++ +R+LCD G + Sbjct: 181 EDDAMASIE--RIFKNDAEPS--DIAAIILEPVQGEGGFYAATPGFMKRLRELCDREGIM 236 Query: 268 MILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFDNPF 327 +I DEVQTG GRTG FA E V DI AK++ GG P+ EV + P Sbjct: 237 LIADEVQTGAGRTGTFFAMEQMGVAADITTFAKSIAGG-FPLSGITGRAEVMDAI--GPG 293 Query: 328 LHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGK 387 T+GG+PLACAAALA I V E+ L ++ G + +LA YP + E RG Sbjct: 294 GLGGTYGGSPLACAAALAVIEVFEEEKLLERSNAIGQTIKSAIGELASRYPQ-IAEVRGL 352 Query: 388 GMLMAIEFVDN-----EIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLTLTIEQCE 439 G ++AIE ++N E +E + +++ +RI P+T EQ + Sbjct: 353 GSMIAIELMENGKPAPEYCPQVLTEARNRGLILLSCGTYGNVLRILVPITAPDEQIQ 409 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 425 Length adjustment: 32 Effective length of query: 427 Effective length of database: 393 Effective search space: 167811 Effective search space used: 167811 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory