Align proline racemase (EC 5.1.1.4) (characterized)
to candidate 6937362 Sama_1532 putative proline racemase (RefSeq)
Query= BRENDA::A8DEZ8 (335 letters) >FitnessBrowser__SB2B:6937362 Length = 346 Score = 229 bits (583), Expect = 1e-64 Identities = 117/337 (34%), Positives = 189/337 (56%), Gaps = 11/337 (3%) Query: 5 RSIQAIDSHTAGEATRIVVGGIPNIKGNSMPEKKEYLEENLDYLRTAIMLEPRGHNDMFG 64 R I +D+HT GE RI+ G P I GN+M +K+++L E+LD R +M EPRGH DM+G Sbjct: 15 RRITTLDAHTEGEPLRIITSGYPAIPGNTMLDKRKFLAEHLDEYRQLLMFEPRGHADMYG 74 Query: 65 SVMTQPCCPDADFGIIFMDGGGYLNMCGHGTIGAMTAAIETGVVPAVEPVTHVVMEAPAG 124 ++T+P ADFG++F+ GY +MCGH + T +TG + + ++APAG Sbjct: 75 VLLTEPVSKGADFGVLFLHNEGYSSMCGHAVLALATVLCQTGAIDFDGCSAEIGIDAPAG 134 Query: 125 IIRGDVTVVDGKAKEVSFLNVPAFLYKEGVEVDLPGVGTVKFDISFGGSFFAIIHASQLG 184 IR + SFLNVP++ + +++PG+G V FDI FGG+++A + A LG Sbjct: 135 FIRAFAEKDTTGRIQASFLNVPSWAEALDLSIEVPGIGEVPFDIGFGGAYYAYVDADALG 194 Query: 185 LKIEPQNAGKLTELAMKLRDIINEKIEIQHPTLAHIKTVDLVEIYD------EPTHPEAT 238 L N +L + +++ + I+HP DL +Y P A Sbjct: 195 LDCSADNVSQLIDWGRRIKQAVMASYPIKHPL-----DEDLSFLYGTIFTSRHTAVPGAH 249 Query: 239 YKNVVIFGQGQVDRSPCGTGTSAKLATLHAKGELKVGEKFVYESILGTLFKGEIVEETKV 298 ++V +F G+VDRSP GTG + ++A LHA+G++++ + ESI+G E E Sbjct: 250 SRHVCVFADGEVDRSPTGTGVAGRIALLHARGKVELAQALTIESIVGGKMTVEARERVDF 309 Query: 299 ADFNAVVPKITGSAYITGFNHFVIDEEDPLKHGFILK 335 +A++P+++G A+ITG + F++ +D + GF+L+ Sbjct: 310 HGRDALIPRVSGRAFITGEHTFLLHPDDIFQTGFLLR 346 Lambda K H 0.319 0.139 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 346 Length adjustment: 28 Effective length of query: 307 Effective length of database: 318 Effective search space: 97626 Effective search space used: 97626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory