Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate 6936200 Sama_0389 short chain dehydrogenase (RefSeq)
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__SB2B:6936200 Length = 270 Score = 82.8 bits (203), Expect = 7e-21 Identities = 63/202 (31%), Positives = 101/202 (50%), Gaps = 9/202 (4%) Query: 15 VLISGAAAGIGAAIAQAFLDVGANVYICD-----VDPAAIDRARTAHPQLHAGV--ADVS 67 V+++GA+ GIG A+A+ +G ++ + + A++ A+ Q V AD++ Sbjct: 9 VILTGASEGIGRALARELARLGCHLVLTARSETRLQSLALELAQEQGAQADVLVHSADLT 68 Query: 68 DCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRK 127 + +ID ++ G LD+LINNAG+ + E D A E+ + N + Sbjct: 69 HPHECRELIDACIARFGRLDILINNAGMTMWSRFDELEDLAILEQIMAVNYLAPARLTHM 128 Query: 128 AVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAI 187 A+P LK + ++A+ASVAG G R+ YAASK A++G SL IEL + V V I Sbjct: 129 ALPHLKHSQGQ--VVAIASVAGLTGVPTRSGYAASKHAMMGFFDSLRIELADDKVAVTVI 186 Query: 188 LPGVVEGERMDRVISARAESLG 209 P V + R + + LG Sbjct: 187 CPDFVVSQIHKRALDGKGNPLG 208 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 270 Length adjustment: 25 Effective length of query: 238 Effective length of database: 245 Effective search space: 58310 Effective search space used: 58310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory