Align 2-Deoxy-D-ribose porter, DeoP (characterized)
to candidate 6936374 Sama_0562 glucose/galactose transporter (RefSeq)
Query= TCDB::Q8XEV7 (438 letters) >FitnessBrowser__SB2B:6936374 Length = 413 Score = 194 bits (492), Expect = 6e-54 Identities = 128/415 (30%), Positives = 203/415 (48%), Gaps = 30/415 (7%) Query: 22 FILLSCLFPLWGCAAALNDILITQFKSVFSLSNFASALVQSAFYGGYFLIAIPASLVIKK 81 F ++ LF +WG ALNDILI K +F LS + LVQ F+G YFL++ A ++I + Sbjct: 25 FGAMTSLFFIWGFITALNDILIPHLKGIFDLSYTQAMLVQFCFFGAYFLVSPLAGVLIAR 84 Query: 82 TSYKVAILIGLTLYIVGCTLFFPASHMATYTMFLAAIFAIAIGLSFLETAANTYSSMIGP 141 Y I+ GL+ GC LF+PAS + Y +FL A+F +A G++ L+ +AN + + +GP Sbjct: 85 IGYLRGIIFGLSTMATGCLLFYPASSLEQYALFLLALFVLASGITILQVSANPFVARLGP 144 Query: 142 KAYATLRLNISQTFYPIGAAAGILLGKYLVFSEGESLEKQMAGMNAEQVHNFKVLMLENT 201 + A RLN++Q +G G L G L+F AG + E Sbjct: 145 ERTAASRLNLAQALNSLGHTLGPLFGSLLIFGAA-------AGTH------------EAV 185 Query: 202 LEPYKYMIMVLVVVMVLFLLTRFPTCKVAQTASHKRPSALDTLRYLASNARFRRGIVAQF 261 PY + V+ ++ V F+ H+ + L S+ R G +A F Sbjct: 186 QLPYLLLAAVIGIIAVGFIFLGGKVKHADMGVDHRHKGS------LLSHKRLLLGALAIF 239 Query: 262 LYVGMQVAVWSFTIRLALE--LGDINERDASTFMVYSFACFFIGKFIANILMTRFNPEKV 319 LYVG +V++ SF + E +G ++E+ A+ + + + IG+F L RFNP V Sbjct: 240 LYVGAEVSIGSFLVNYFAEPSIGGLDEKSAAELVSWYWGGAMIGRFAGAALTRRFNPAMV 299 Query: 320 LILYSVIGALFLAYVALAPSFSAVYVAVLVSVLFGPCWATIYAGTLDTVDNEHTEMAGAV 379 L +V L L ++ A+ + V + TI+ ++ + E T + Sbjct: 300 LAANAVFANLLLMLTIVSSGELALVAVLAVGFFNSIMFPTIFTLAIEGL-GELTSRGSGL 358 Query: 380 IVMAIVGAAVVPAIQGYVADMFHSLQLSFLVSMLCFVYVGVY-FWRESKVRGNLA 433 + AIVG A++P IQG VAD +QLSF+V C+ Y+ Y F+ +++ G A Sbjct: 359 LCQAIVGGALLPVIQGVVADNV-GVQLSFIVPTFCYFYICWYAFFARNRMNGETA 412 Lambda K H 0.329 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 413 Length adjustment: 32 Effective length of query: 406 Effective length of database: 381 Effective search space: 154686 Effective search space used: 154686 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory