GapMind for catabolism of small carbon sources

 

Aligments for a candidate for garK in Shewanella amazonensis SB2B

Align glycerate 2-kinase (EC 2.7.1.165) (characterized)
to candidate 6939130 Sama_3228 glycerate kinase (RefSeq)

Query= BRENDA::P23524
         (381 letters)



>lcl|FitnessBrowser__SB2B:6939130 Sama_3228 glycerate kinase
           (RefSeq)
          Length = 384

 Score =  434 bits (1115), Expect = e-126
 Identities = 231/378 (61%), Positives = 277/378 (73%), Gaps = 7/378 (1%)

Query: 1   MKIVIAPDSYKESLSASEVAQAIEKGFREIFPDAQYVSVPVADGGEGTVEAMIAATQGAE 60
           MKIVIAPDS+KESLSA EVA AIE GF+ + PDA Y+ +P+ADGGEGTV++++ AT G  
Sbjct: 1   MKIVIAPDSFKESLSAMEVADAIEAGFKRVLPDATYIKLPMADGGEGTVQSLVDATGGTI 60

Query: 61  RHAWVTGPLGEKVNASWGISGDGKT-------AFIEMAAASGLELVPAEKRDPLVTTSRG 113
               VT PLG KV A +G+ G  K        A IEMAAASGL LV  E R+PL+T+S G
Sbjct: 61  VPVEVTAPLGNKVEAFFGLLGSAKEKGDSCVRAVIEMAAASGLHLVAPELRNPLLTSSFG 120

Query: 114 TGELILQALESGATNIIIGIGGSATNDGGAGMVQALGAKLCDANGNEIGFGGGSLNTLND 173
           TGELIL ALE G T++I+GIGGSATNDGGAGM+ ALG KL  A+G+ I  GGGSL  L+ 
Sbjct: 121 TGELILAALERGVTHLILGIGGSATNDGGAGMITALGGKLLKADGSPIALGGGSLAELSH 180

Query: 174 IDISGLDPRLKDCVIRVACDVTNPLVGDNGASRIFGPQKGASEAMIVELDNNLSHYAEVI 233
           ID++GLDPRL    I VACDV NPL G  GAS +FGPQKGA+  M+  LD NL+ YA  I
Sbjct: 181 IDLTGLDPRLAGLTIDVACDVNNPLCGPKGASAVFGPQKGATPEMVTLLDANLARYANCI 240

Query: 234 KKALHVDVKDVPGAGAAGGMGAALMAFLGAELKSGIEIVTTALNLEEHIHDCTLVITGEG 293
           +  L   VKD+PGAGAAGGMGAAL+  LGAELK GI+IV  AL L + + D  LVITGEG
Sbjct: 241 ESTLGKPVKDIPGAGAAGGMGAALVGLLGAELKPGIQIVIEALKLADALADADLVITGEG 300

Query: 294 RIDSQSIHGKVPIGVANVAKKYHKPVIGIAGSLTDDVGVVHQHGIDAVFSVLTSIGTLDE 353
            IDSQ+IHGK PIGVA+ AK++ KPVIGIAG L+DD GVVH+HG+DAVF+V+    TL E
Sbjct: 301 CIDSQTIHGKTPIGVASCAKQFGKPVIGIAGCLSDDCGVVHEHGLDAVFAVVNRAMTLPE 360

Query: 354 AFRGAYDNICRASRNIAA 371
           A   A  NI + +RN+AA
Sbjct: 361 ALATAGTNIEQTARNVAA 378


Lambda     K      H
   0.315    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 481
Number of extensions: 18
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 381
Length of database: 384
Length adjustment: 30
Effective length of query: 351
Effective length of database: 354
Effective search space:   124254
Effective search space used:   124254
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory