GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ackA in Shewanella amazonensis SB2B

Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate 6938704 Sama_2807 phosphoribosylglycinamide formyltransferase 2 (RefSeq)

Query= SwissProt::P33221
         (392 letters)



>lcl|FitnessBrowser__SB2B:6938704 Sama_2807
           phosphoribosylglycinamide formyltransferase 2 (RefSeq)
          Length = 392

 Score =  524 bits (1349), Expect = e-153
 Identities = 269/389 (69%), Positives = 313/389 (80%), Gaps = 1/389 (0%)

Query: 3   LLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINML 62
           ++GT     ATR MLLGSGELGKEVAIE QRLGVEVIAVDRY +APAM VAHRSHVINML
Sbjct: 1   MIGTPYTQGATRAMLLGSGELGKEVAIELQRLGVEVIAVDRYPNAPAMQVAHRSHVINML 60

Query: 63  DGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTMNREGIRRLAA 122
           DG+AL+ ++  EKPH ++PEIEAIAT  L++LE EGL VVP ARAT+LTM+REGIRRLAA
Sbjct: 61  DGEALKALIASEKPHLVIPEIEAIATQTLVELEAEGLKVVPTARATRLTMDREGIRRLAA 120

Query: 123 EELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKYAQ 182
           E L LPTS Y F DS +  + A+   G PC+VKPVMSSSGKGQ+ IRS   + +AW YAQ
Sbjct: 121 ETLALPTSPYVFCDSLTELQAALKVTGIPCVVKPVMSSSGKGQSVIRSPGDVQKAWDYAQ 180

Query: 183 QGGRAGAGRVIVEGVVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMSPL 242
            GGRAG GR+IVEG + FD+EITLLT+SAVDG+HFCAP+GHRQEDGDYRESWQPQ MS L
Sbjct: 181 SGGRAGEGRIIVEGFIDFDYEITLLTISAVDGIHFCAPIGHRQEDGDYRESWQPQAMSSL 240

Query: 243 ALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEFAL 302
           AL+RAQ IAR+VV  LGG+GLFGVELF+ GDEV FSEVSPRPHDTGMVTLISQDLSEFAL
Sbjct: 241 ALDRAQHIAREVVQNLGGFGLFGVELFIKGDEVYFSEVSPRPHDTGMVTLISQDLSEFAL 300

Query: 303 HVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVG-ADLQIRLFGKPEIDGS 361
           HVRA LGLPVG I Q GP+ASAVIL +  S N+ +  +  A+   + Q+RLF KPEI G 
Sbjct: 301 HVRAILGLPVGTIVQRGPSASAVILVEGESSNIGYSGLAEALAQPNTQLRLFAKPEIHGR 360

Query: 362 RRLGVALATAESVVDAIERAKHAAGQVKV 390
           RRLGVALA   S+ +A++ A  +AG +KV
Sbjct: 361 RRLGVALARGTSIDEALQTALASAGCIKV 389


Lambda     K      H
   0.320    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 472
Number of extensions: 18
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 392
Length of database: 392
Length adjustment: 31
Effective length of query: 361
Effective length of database: 361
Effective search space:   130321
Effective search space used:   130321
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory