Align alcohol dehydrogenase [NAD(P)+] (EC 1.1.1.71) (characterized)
to candidate 6938606 Sama_2709 D-isomer specific 2-hydroxyacid dehydrogenase family protein (RefSeq)
Query= BRENDA::Q8H0L8 (359 letters) >FitnessBrowser__SB2B:6938606 Length = 348 Score = 317 bits (811), Expect = 4e-91 Identities = 159/345 (46%), Positives = 230/345 (66%), Gaps = 5/345 (1%) Query: 11 IKAFGWATRHTSGVLSPFNFSRRVTGEKHVQFKVMYCGICHSDLHQLKNEWGNTKYPMVP 70 +K G+A + L+P+ ++ R E V +++Y G+CHSDLH +KN+WG T YP VP Sbjct: 1 MKTIGYAAQSALSPLAPYEYTCRELREDDVAIEILYSGVCHSDLHTVKNDWGWTVYPTVP 60 Query: 71 GHEVVGVVIEVGSKVEKFKVGDKVGVGCMVGSCRKCENCTVDLENYCPRQIP-TYNGYSL 129 GHE+VG V+++G+ V +F++GD V VGCMV SC+ C +C E +C + TYN Sbjct: 61 GHEIVGRVVDIGASVTQFRIGDNVAVGCMVDSCQTCSHCHSGEEQFCEQGFTQTYNSAER 120 Query: 130 -DGTLTFGGYSDMMVSDEHFVVRWPENLSMD-AAPLLCAGITTYSPLKYFGLDKPGMHIG 187 G +T GGY+ +V + FV++ P +L + AAPLLCAGITTYSPL+ + + PG + Sbjct: 121 HSGEITKGGYARHIVVRQEFVLQIPPSLDLARAAPLLCAGITTYSPLRTWQVG-PGSRVA 179 Query: 188 VVGLGGLGHMAVKFAKAFGTKVTVISTSANKKQEAIERLGADSFLISRDPEQMKAAMNTL 247 V+G+GGLGHMA+K A A G VTVIS +A+K+ +A++ LGA+ FLIS + E M+ A N Sbjct: 180 VIGMGGLGHMAIKLAVAMGAHVTVISRTADKRADAMQ-LGANEFLISSETESMQQAANRF 238 Query: 248 DGIIDTVSAVHPILPLLMLMKSHGKLVMVGAPEKPVELPVFPLLMGRKLVAGSCIGGMKE 307 + I+DT+ H + P + L+K G L +VG E+ P++MGR+ +A S IGG+ E Sbjct: 239 ELILDTIPVKHDVTPYMPLLKVDGTLTLVGQVGPMAEVNTVPMIMGRRRIAASLIGGIAE 298 Query: 308 TQEMLDFAAKHNITPDIEVVPMDYVNTALERLLKSDVKYRFVLDI 352 TQEMLDF A+ NI P++E++ M+ +N A ERL KSDV YRFV+D+ Sbjct: 299 TQEMLDFCARMNILPEVEMITMEQINDAFERLEKSDVHYRFVIDM 343 Lambda K H 0.320 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 348 Length adjustment: 29 Effective length of query: 330 Effective length of database: 319 Effective search space: 105270 Effective search space used: 105270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory