Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate 6939300 Sama_3393 3-ketoacyl-(acyl-carrier-protein) reductase (RefSeq)
Query= uniprot:B2T9V3 (247 letters) >FitnessBrowser__SB2B:6939300 Length = 241 Score = 95.1 bits (235), Expect = 1e-24 Identities = 76/252 (30%), Positives = 125/252 (49%), Gaps = 30/252 (11%) Query: 8 KTALITAAGQGIGLATAELFAREG--------ARVIATDIRIDGLA--GKPVEARKLDVR 57 K L+T + +GIG A A A +G + + A + +A G V K DV Sbjct: 3 KRVLVTGSSRGIGKAIALRLASQGYDVAVHYHSNLTAAEATASEIADLGVKVSLLKFDVA 62 Query: 58 DDAAIKA-LAAEIGAVDVLFNC---AGFVHAGNILECSEEDWDFAFDLNVKAMYRMIR-A 112 D AA++A + A+I A + AG +++DWD N+ Y +++ Sbjct: 63 DRAAVRAAIEADIEANGAYYGVVLNAGINRDTAFPAMTDDDWDSVIHTNLDGFYNVVQPT 122 Query: 113 FLPAMLDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNAI 172 +P + + GG II ++S S + G + YSASKA +IG TK+++ + R + N I Sbjct: 123 VMPMIQSRKGGRIITLASV-SGIAGNRGQVNYSASKAGLIGATKALSLELAKRKITVNCI 181 Query: 173 CPGTVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDESS 232 PG + E +V++ ++ +D + PM R+GKPEEIAALA +L SD+++ Sbjct: 182 APGLI-----ETDMVSEFPSE--MVDQL-------VPMRRMGKPEEIAALAGFLMSDDAA 227 Query: 233 FTTGHAHVIDGG 244 + T ++GG Sbjct: 228 YITRQVISVNGG 239 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 115 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 241 Length adjustment: 24 Effective length of query: 223 Effective length of database: 217 Effective search space: 48391 Effective search space used: 48391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory