Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate 6937839 Sama_1980 3-oxoacyl-(acyl-carrier-protein) reductase (RefSeq)
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >FitnessBrowser__SB2B:6937839 Length = 248 Score = 115 bits (289), Expect = 7e-31 Identities = 78/247 (31%), Positives = 126/247 (51%), Gaps = 9/247 (3%) Query: 19 LKNKVVLLTGAAQGIGEAIVATFASQQARLVISDIQGEKVEKVAAHWREQGADVVAIKAD 78 L KV L+TGA++GIG+AI T A A +V + + ++ + ++G +V + Sbjct: 7 LTGKVALVTGASRGIGKAIALTLAEAGATVVGTATSEKGAAAISDYLGDKGFGLVL---N 63 Query: 79 VSRQQDLHAMARLAIELHGRIDVLVNCAGVNVFRDPLQMTEEDWHRCFAIDLDGAWYGCK 138 V+ + + M E G +D+LVN AG+ ++M +E+W +L + K Sbjct: 64 VTSSESVAEMYTAIKEKAGDVDILVNNAGITRDNLLMRMKDEEWEEIIDTNLTSLYRLSK 123 Query: 139 AVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGIRVNAI 198 V+ M+++ G II+I S T G Y AK GL+G T++L E A + I VNAI Sbjct: 124 PVMRSMMKKRHGRIISIGSVVGTMGNAGQVNYSAAKAGLIGFTKSLAREVASRQITVNAI 183 Query: 199 APGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPFINAS 258 APG+I+T + + ++Q P R+GQ E+A +FLASD A +I Sbjct: 184 APGFIQTDMTDEL------TPEQQQGIMSQVPMERLGQAQEIANAVLFLASDAAAYITGE 237 Query: 259 CITIDGG 265 + ++GG Sbjct: 238 TLHVNGG 244 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 248 Length adjustment: 24 Effective length of query: 248 Effective length of database: 224 Effective search space: 55552 Effective search space used: 55552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory