Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate 6936480 Sama_0668 iron(III) ABC transporter, ATP-binding protein (RefSeq)
Query= reanno::Phaeo:GFF2754 (331 letters) >FitnessBrowser__SB2B:6936480 Length = 341 Score = 202 bits (515), Expect = 7e-57 Identities = 119/316 (37%), Positives = 174/316 (55%), Gaps = 26/316 (8%) Query: 1 MTALQLTNVCKSFGPVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEI 60 M+ L + + + +VL+ +NLT+ GE +GPSGCGK+TLLR I+GL+D +AG I Sbjct: 1 MSTLSIQGLHSDYRGEQVLRGLNLTLTQGEITALLGPSGCGKTTLLRTIAGLQDISAGSI 60 Query: 61 SIGGQTVTT----TPPAKRGIAMVFQSYALYPHLSVRENMALALKQERQPKEEIAARVAE 116 +I G+TV+ P KR I M+FQ YAL+PHL+V +N+ ++Q K+ + R+ E Sbjct: 61 AINGKTVSADGCFVAPEKRSIGMIFQDYALFPHLTVADNILFGVRQ--LDKQSRSVRLEE 118 Query: 117 ASRMLSLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEI 176 ++ LE R P ELSGGQ+QRV+I RA+ EP L L DEP SN+DA +R LEI Sbjct: 119 MLSLVKLEGLGKRYPHELSGGQQQRVSIARALAYEPDLLLLDEPFSNIDAQVRRALMLEI 178 Query: 177 ARLHRQLSASMIYVTHDQIEAMTLADKIVVLRDGRIEQVGTPMELYNNPANRFVAEFIGA 236 + + + S ++VTH + EA AD + + GRI Q G P LY +P +VA+F+G Sbjct: 179 RAILKARNVSAVFVTHSKDEAFAFADTLALFEAGRIVQHGIPETLYQSPNTPYVADFLG- 237 Query: 237 PAMNFVPAQRLGGNPGQFIG------------------IRPEYARISPVGPLAGEVIHVE 278 A N++ + G +G +RPE I AGE++ Sbjct: 238 -ASNYLDVRLEAGQLISTLGAFPLPQDFKAASETGRWLLRPEQLLIEARADGAGEILERR 296 Query: 279 KLGGDTNILVDMGEDL 294 LG + LV +GE + Sbjct: 297 FLGNGCHYLVRLGEQV 312 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 341 Length adjustment: 28 Effective length of query: 303 Effective length of database: 313 Effective search space: 94839 Effective search space used: 94839 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory