Align Glucosamine kinase GspK; GlcN kinase; EC 2.7.1.8 (characterized)
to candidate 6936101 Sama_0298 ATPase, BadF/BadG/BcrA/BcrD type (RefSeq)
Query= SwissProt::Q9KUA9 (294 letters) >FitnessBrowser__SB2B:6936101 Length = 327 Score = 154 bits (388), Expect = 3e-42 Identities = 93/280 (33%), Positives = 148/280 (52%), Gaps = 3/280 (1%) Query: 3 YYVGIDGGGTSCRARIRNQQGEWVGEAKSGSANIMLGVEVALRSVVDAITQAAEQGGLSP 62 ++VGID GG+ CRA + + G+ +G +G AN + GV + +++ AI +A L Sbjct: 38 FWVGIDAGGSHCRALLTDDSGQVLGHGVAGPANPVNGVSQSQAAIMSAIDKALGAARLDK 97 Query: 63 DDFPSMHVGLALAGAEQKEAWHAFMQQAHPFASITLNTDAYGACLGAHLGEEGAIMIAGT 122 + + VG LAG + + AHPFA+ TD + A LGAH G +G ++I GT Sbjct: 98 Q-YHRLIVGAGLAGLHLPKMQQVMNEWAHPFAAWHTTTDLHVAALGAHQGADGGVIILGT 156 Query: 123 GSCGILLKGGKQYVVGGREFPISDQGSGAVMGLRLIQQVLLAQDGIRPHTPLCDVVMNHF 182 G + G+Q ++GG FPI+ SG+ GL ++ VLL DGI P T L ++ Sbjct: 157 GFSSLANVKGQQILIGGHGFPINATCSGSWFGLEAVKAVLLDADGIGPGTSLTGKLLQGT 216 Query: 183 NHDIDSIVAWSKTALPRDYGQFSPQIFSHAYCGDPLAIELLKQTAADIEMFLIALHHKGA 242 N ++ A D+ +F+PQ+F A GD +++ L++Q A I + L G Sbjct: 217 N--AMALAEQLMHANATDFARFAPQVFEQAGAGDAVSLSLIEQGATFINGVIRRLLATGI 274 Query: 243 ERICLMGSIAERIQDWLSPPVQQWIVKPQSDAIEGALMFA 282 + + L+G IA +Q WL+P + I ++ EGA++FA Sbjct: 275 DSLSLVGGIAPLMQPWLAPDLSTRIRTAKASPEEGAILFA 314 Lambda K H 0.320 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 327 Length adjustment: 27 Effective length of query: 267 Effective length of database: 300 Effective search space: 80100 Effective search space used: 80100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory