Align N-acetylgalactosamine-6-phosphate deacetylase; GalNAc-6-P deacetylase; N-acetylglucosamine-6-phosphate deacetylase; GlcNAc-6-P deacetylase; EC 3.5.1.-; EC 3.5.1.25 (characterized)
to candidate 6937024 Sama_1198 N-acetylglucosamine-6-phosphate deacetylase (RefSeq)
Query= SwissProt::A0KYQ5 (394 letters) >FitnessBrowser__SB2B:6937024 Length = 411 Score = 360 bits (924), Expect = e-104 Identities = 199/386 (51%), Positives = 245/386 (63%), Gaps = 5/386 (1%) Query: 4 NTDFMLIA--DGAKVLTQGNLTEHCAIEVSDGIICGLKSTISAEWTADKPHYRLTSGTLV 61 N +F+L+ D ++ GN +V I G TIS D P YRL G L Sbjct: 19 NPEFVLVGADDASEFGVTGNAIAALVPDVWLKISQGHIETISRRPDVDLPQYRLP-GILA 77 Query: 62 AGFIDTQVNGGGGLMFNHVPTLETLRLMMQAHRQFGTTAMLPTVITDDIEVMQAAADAVA 121 +DTQVNGGGG++ NH PT + + Q H Q+GT A+LPTVI+D++ VM+ A D Sbjct: 78 PALVDTQVNGGGGVLINHQPTAAGINTLTQTHGQYGTGALLPTVISDNLAVMEQALDGAI 137 Query: 122 EAIDCQVPGIIGIHFEGPHLSVAKRGCHPPAHLRGITEREWLLYLRQ--DLGVRLITLAP 179 A ++GIHFEGPHLS+AK+GCH PA +R I E E LY LG ++TLAP Sbjct: 138 AARQGGDAAVVGIHFEGPHLSLAKKGCHSPALIRPIGEAEMTLYADAVAALGCCMVTLAP 197 Query: 180 ESVTPEQIKRLVASGAIISLGHSNADGETVLKAIEAGASGFTHLYNGMSALTSREPGMVG 239 E+V P I RLVA G +SLGHSNAD TV ++ AGASGFTHL+NGMSAL REPGMVG Sbjct: 198 ETVEPADIARLVALGVRVSLGHSNADVATVEASLAAGASGFTHLFNGMSALQGREPGMVG 257 Query: 240 AAFASENTYCGIILDGQHVHPISALAAWRAKGTEHLMLVTDAMSPLGSDQTEFQFFDGKV 299 AA A YCGIILDG+HVH SA AWR KGT LMLVTDAMSP G+ + F+FF GKV Sbjct: 258 AALACPEAYCGIILDGEHVHATSATLAWRLKGTRRLMLVTDAMSPTGTREESFEFFGGKV 317 Query: 300 VREGMTLRDQHGSLAGSVLDMASAVRYAATELNLGLSNAVQMATRTPAEFIQRPQLGDIA 359 R+GM LRD+ GSLAGSVL M +AVR A L + + A+ MAT TPA F+ +G +A Sbjct: 318 HRDGMVLRDEQGSLAGSVLTMTAAVRQACAMLGVSAAEALWMATATPAAFLGLKDIGRLA 377 Query: 360 EGKQADWVWLDDDQRVLAVWIAGELL 385 G +AD + LDD L W AG+L+ Sbjct: 378 PGNRADLLLLDDALYQLGRWQAGQLV 403 Lambda K H 0.320 0.134 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 497 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 411 Length adjustment: 31 Effective length of query: 363 Effective length of database: 380 Effective search space: 137940 Effective search space used: 137940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate 6937024 Sama_1198 (N-acetylglucosamine-6-phosphate deacetylase (RefSeq))
to HMM TIGR00221 (nagA: N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00221.hmm # target sequence database: /tmp/gapView.1906884.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00221 [M=380] Accession: TIGR00221 Description: nagA: N-acetylglucosamine-6-phosphate deacetylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-77 246.5 0.0 2.8e-77 246.2 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6937024 Sama_1198 N-acetylglucosamine-6- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6937024 Sama_1198 N-acetylglucosamine-6-phosphate deacetylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 246.2 0.0 2.8e-77 2.8e-77 25 368 .. 50 389 .. 34 394 .. 0.90 Alignments for each domain: == domain 1 score: 246.2 bits; conditional E-value: 2.8e-77 TIGR00221 25 vindekikavvteaeleeeikeidlkgnvltpGliDvqlnGcgGvdtndasv.etleimsealaksGvtsfLptlit 100 i ++ i++++ + + + + l+g +l+p l+D q+nG+gGv +n + + ++ + ++ ++G+ + Lpt+i+ lcl|FitnessBrowser__SB2B:6937024 50 KISQGHIETISRRP--DVDLPQYRLPG-ILAPALVDTQVNGGGGVLINHQPTaAGINTLTQTHGQYGTGALLPTVIS 123 56666666665333..33344445555.89******************9877699********************** PP TIGR00221 101 redeeikkavkvareylakeknakiLGlhleGPflslekkGahpkeyirepdvellkkfldeagdv.itkvtlapee 176 + +++a+ a+++ ++ ++G+h+eGP+lsl kkG h + ir++ + + + d+ + + +vtlape lcl|FitnessBrowser__SB2B:6937024 124 DNLAVMEQALDGAIAARQGGDA-AVVGIHFEGPHLSLAKKGCHSPALIRPIGEAEMTLYADAVAALgCCMVTLAPET 199 ***********99998876665.9**************************987776888888776526789****77 PP TIGR00221 177 kqtaelisklleagiivsaGhtnatyeelkeafkaGitfathlynamskldhRepgviGavLdeddvvteiiaDGlh 253 ++a++ +l+ g+ vs+Gh+na++++++++ aG++ thl+n ms l++Repg++Ga+L+ + +++ii DG h lcl|FitnessBrowser__SB2B:6937024 200 VEPADI-ARLVALGVRVSLGHSNADVATVEASLAAGASGFTHLFNGMSALQGREPGMVGAALACPEAYCGIILDGEH 275 777775.568999**************************************************************** PP TIGR00221 254 ihpknirlakklkgdsklvlvtDslaaagaklekfifaGkevyiredtlldkngtlaGssltmiegvknlvefveis 330 +h + + la +lkg +l+lvtD++++ g++ e+f+f G +v + l d++g laGs+ltm +v+++ ++s lcl|FitnessBrowser__SB2B:6937024 276 VHATSATLAWRLKGTRRLMLVTDAMSPTGTREESFEFFGGKVHRDGMVLRDEQGSLAGSVLTMTAAVRQACAMLGVS 352 ******************************************999999999************************** PP TIGR00221 331 lsdvvrisslnparalgiddrlGsvakGkdanLavltk 368 ++++ +++ pa lg++d G +a G a+L +l+ lcl|FitnessBrowser__SB2B:6937024 353 AAEALWMATATPAAFLGLKDI-GRLAPGNRADLLLLDD 389 *******************98.***********99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (380 nodes) Target sequences: 1 (411 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 20.02 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory