GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagB in Shewanella amazonensis SB2B

Align D-galactosamine-6-phosphate deaminase AgaS; GalN-6-P deaminase; Glucosamine-6-phosphate deaminase; GlcN-6-P deaminase; EC 3.5.99.-; EC 3.5.99.6 (characterized)
to candidate 6937022 Sama_1196 phosphosugar isomerase (RefSeq)

Query= SwissProt::A0KYQ7
         (386 letters)



>lcl|FitnessBrowser__SB2B:6937022 Sama_1196 phosphosugar isomerase
           (RefSeq)
          Length = 397

 Score =  385 bits (990), Expect = e-112
 Identities = 194/361 (53%), Positives = 260/361 (72%), Gaps = 4/361 (1%)

Query: 27  GAFWTAKEISQQPKMWRKVSEQHSDNRT-IAAWLTPILAKPQLRIILTGAGTSAYIGDVL 85
           G+ WTA+EI QQP++WR+++EQ    ++ +  +  P+LA P LR+ILTGAGTSAYIG+ L
Sbjct: 26  GSQWTAEEICQQPRLWREMAEQFVQEKSRLQDFAAPLLALPDLRVILTGAGTSAYIGEAL 85

Query: 86  AAHIQQHLPLATQQVEAISTTDIVSHPELYLRGNIPTLLISYGRSGNSPESMAAVELAEQ 145
           A  +   +PL  Q VEAI+TTD+VSHP LYL    PTL+IS+GRSG+SPESMAA+EL + 
Sbjct: 86  APFLATQMPLVGQTVEAIATTDLVSHPHLYLHPARPTLVISFGRSGSSPESMAAIELCDA 145

Query: 146 LVDDCYHLAITCNGQGKLANYCADKSH-CYLYKLPDETHDVSFAMTSSFTCMYLATLLIF 204
           L+  CYHL +TCN QG +A Y   ++    L+ +P+ +HD SFAMTSSF+CMYL  LL+F
Sbjct: 146 LLPRCYHLLLTCNPQGSMARYGEQQAQRACLWLMPEGSHDRSFAMTSSFSCMYLGVLLLF 205

Query: 205 APNSQALMQCIEMAEHILTERLADIRLQSEQPSKRVVFLGGGPLKAIAQEAALKYLELTA 264
           A N  AL + + +AE +L +R+ +I   +  P  RVVFLGGG L+ IA+EAALK LEL+A
Sbjct: 206 AANYSALARAVTLAERMLCDRVDEIAKLAALPLSRVVFLGGGTLQGIAREAALKLLELSA 265

Query: 265 GQVVSAFESPLGFRHGPKSLVDSHTQVLVMMSSDPYTRQYDNDLIQELKRDNQALSVLTL 324
           G V+   ESPLGFRHGPKSL+D  + V+V+ SS+PY R YD D+  EL+RD  A +++ L
Sbjct: 266 GAVMGVHESPLGFRHGPKSLIDKDSLVVVLCSSEPYARAYDMDMAAELERDGAASALVRL 325

Query: 325 SEELLTGSSG--LNEVWLGLPFILWCQILAIYKAIQLKVSPDNPCPTGQVNRVVQGVNVY 382
            EE +   +   L +VWL  P+IL+CQ+ A +KA+ L +S DNPCP GQVNRVVQGV +Y
Sbjct: 326 CEENVGADAQTLLEDVWLTFPYILYCQLFAYFKALNLGISADNPCPGGQVNRVVQGVKIY 385

Query: 383 P 383
           P
Sbjct: 386 P 386


Lambda     K      H
   0.319    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 383
Number of extensions: 15
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 386
Length of database: 397
Length adjustment: 31
Effective length of query: 355
Effective length of database: 366
Effective search space:   129930
Effective search space used:   129930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory