Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate 6939551 Sama_3639 glucosamine--fructose-6-phosphate aminotransferase (RefSeq)
Query= reanno::Korea:Ga0059261_1644 (347 letters) >FitnessBrowser__SB2B:6939551 Length = 609 Score = 123 bits (308), Expect = 1e-32 Identities = 106/356 (29%), Positives = 171/356 (48%), Gaps = 31/356 (8%) Query: 14 MEREAAEAGAAVSRMLA---ANRDAIE-----RVAARLRASPPAVVVTCARGSSDHAATY 65 M +E E A++R L AN ++ + A L+ ++ C G+S HA Sbjct: 253 MLKEIYEQPRALARTLEGRIANMQVLDSAFGDKAADLLKDIKHVQIIAC--GTSYHAGMT 310 Query: 66 AKYLIETLTGVPTASAALSVASLYDAPVAPGNGLCLAISQSGKSPDLLATVEHQRKAG-A 124 A+Y +E GV S + + P N L + ISQSG++ D LA + ++ G Sbjct: 311 ARYWLEQWAGVSCNVEIASEFRYRKSHLFP-NSLLVTISQSGETADTLAALRLAKEMGYQ 369 Query: 125 FVVAMVNAEDSPLAALADIVIPLKAGPERSVAATKSYICSLAAIAALVAAWAQDE----- 179 + + NA S L +D+ +KAG E VA+TK++ LA + L A ++ Sbjct: 370 ATLTICNAPGSSLVRESDMAYMMKAGAEIGVASTKAFTVQLAGLLMLTAVIGRNNGMSAE 429 Query: 180 ---ALETAVADLPAQLERAFALDWSAAVTALTGAS---GLFVLGRGYGYGIAQEAALKFK 233 +L ++ LPA++E+A LD + A A A LF LGRG Y IA E ALK K Sbjct: 430 LQSSLTQSLQSLPAKVEQALGLDDAIASLAEDFADKHHALF-LGRGDQYPIAMEGALKLK 488 Query: 234 ETCALHAESFSAAEVRHGPMAIVGEAFHVLAFASSDRAGESVRETVAEFRSRGAEV-LLA 292 E +HAE++++ E++HGP+A++ V+ A ++ E ++ V E R+RG + + A Sbjct: 489 EISYIHAEAYASGELKHGPLALIDADMPVIVVAPNNELLEKLKSNVEEVRARGGLMYVFA 548 Query: 293 DPAARQAG------LPAIAAHPAIEPILIVQSFYKMANALALARGCDPDSPPHLNK 342 D A A +P + P++ ++ +AL +G D D P +L K Sbjct: 549 DKDAEFASDDTMKVIPVPHCDEFMAPLIYTIPLQLLSYHVALIKGTDVDQPRNLAK 604 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 609 Length adjustment: 33 Effective length of query: 314 Effective length of database: 576 Effective search space: 180864 Effective search space used: 180864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory