Align N-acetylglucosamine porter, NagP (characterized)
to candidate 6936374 Sama_0562 glucose/galactose transporter (RefSeq)
Query= TCDB::Q8EBL0 (435 letters) >FitnessBrowser__SB2B:6936374 Length = 413 Score = 183 bits (465), Expect = 8e-51 Identities = 141/425 (33%), Positives = 213/425 (50%), Gaps = 51/425 (12%) Query: 8 QKSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTFTALP 67 Q L + +LFFI GF T LN L+P+LK I L+ QA L+ F F+ A + Sbjct: 18 QSHQQLLFGAMTSLFFIWGFITALNDILIPHLKGIFDLSYTQAMLVQFCFFGAYFLVSPL 77 Query: 68 SAWVIRKVGYKNGMALGMGVMMIAGLLFIPAAKTQVFALFLFAQLVMGAGQTLLQTAVNP 127 + +I ++GY G+ G+ M LLF PA+ + +ALFL A V+ +G T+LQ + NP Sbjct: 78 AGVLIARIGYLRGIIFGLSTMATGCLLFYPASSLEQYALFLLALFVLASGITILQVSANP 137 Query: 128 YVVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLTQVQIDEMANG 187 +V RLGPE +AA+R+++ LN + PL S LI F GT Sbjct: 138 FVARLGPERTAASRLNLAQALNSLGHTLGPLFGSLLI---FGAAAGT----------HEA 184 Query: 188 LVLPYLGMAVFIGILALAVKKSPLPELSNEDEVADHTDKSQIKAALSHPNLALGVLALFV 247 + LPYL +A IGI+A+ ++ + D DH K + LSH L LG LA+F+ Sbjct: 185 VQLPYLLLAAVIGIIAVGFIFLG-GKVKHADMGVDHRHKGSL---LSHKRLLLGALAIFL 240 Query: 248 YVAVEVIAGDTIGTFALSL-------GIDHYGV--MTSYTMVCMVLGYILGILLIPRVIS 298 YV EV +IG+F ++ G+D + S+ ++G G L R + Sbjct: 241 YVGAEV----SIGSFLVNYFAEPSIGGLDEKSAAELVSWYWGGAMIGRFAGAALTRR-FN 295 Query: 299 QPTALMISAILGLLLTLGILFGDNNSYAIANLLLVPFGGVALPDTLLLIAFLGLANAIVW 358 L +A+ LL + L +V G +A L+ + +G N+I++ Sbjct: 296 PAMVLAANAVFANLLLM--------------LTIVSSGELA----LVAVLAVGFFNSIMF 337 Query: 359 PAVWPLALSGMGKLTSTGSALLIMGIAGGAFGPVSWGLMSSATDMGQQGGYMVMLPCYLF 418 P ++ LA+ G+G+LTS GS LL I GGA PV G++ A ++G Q ++V CY + Sbjct: 338 PTIFTLAIEGLGELTSRGSGLLCQAIVGGALLPVIQGVV--ADNVGVQLSFIVPTFCYFY 395 Query: 419 ILFYA 423 I +YA Sbjct: 396 ICWYA 400 Lambda K H 0.326 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 435 Length of database: 413 Length adjustment: 32 Effective length of query: 403 Effective length of database: 381 Effective search space: 153543 Effective search space used: 153543 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory