GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagP in Shewanella amazonensis SB2B

Align N-acetylglucosamine transporter nagP (characterized)
to candidate 6936761 Sama_0948 multiple antibiotic resistance (MarC)-related protein (RefSeq)

Query= reanno::ANA3:7025962
         (432 letters)



>lcl|FitnessBrowser__SB2B:6936761 Sama_0948 multiple antibiotic
           resistance (MarC)-related protein (RefSeq)
          Length = 441

 Score =  437 bits (1124), Expect = e-127
 Identities = 232/432 (53%), Positives = 304/432 (70%), Gaps = 11/432 (2%)

Query: 8   QKSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTFTALP 67
           ++SS LPM I+  LFFI GF TWLNGSL+P+LK I +LN FQA  + F+FYIA T  ALP
Sbjct: 13  RRSSVLPMTIIGILFFIFGFVTWLNGSLIPFLKVICELNEFQALFVTFAFYIAYTVMALP 72

Query: 68  SAWVIRKVGYKNGMALGMGIMMLAGLLFIPAAKTQIFGLFLCAQLVMGTGQTLLQTAVNP 127
            + ++R+ GY+NGMA+G+GIM++  L FIPAA +  F LFL A  ++GTG T+LQTA NP
Sbjct: 73  MSSILRRTGYRNGMAIGLGIMVVGSLAFIPAAYSANFLLFLGALFILGTGLTILQTASNP 132

Query: 128 YVVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALI---LDSFKDRIGTTLTQ----VQ 180
           YVV +GP+ESAA R+S+MGI+NK AGV+ PL+F+AL+   L++F +   + L+     VQ
Sbjct: 133 YVVHIGPKESAAMRISIMGIINKLAGVVVPLLFTALVLSGLENFDEAHLSALSDADRAVQ 192

Query: 181 IDEMANSLVFPYLGMAIFIGVLALAVKKSPLPELSNEDEVAEHTDKGQIKAALSHPNLAF 240
           I E+++ LV PY+ MA+ +  L   VK S LPEL  E+  +   +KG I      P +  
Sbjct: 193 ITELSSRLVMPYIYMAVALLALIALVKFSGLPELEFEEAESAEGEKGSI---TQFPQVIL 249

Query: 241 GVIALFVYVAVEVIAGDTIGTFALSLGVEHYGVMTSYTMVCMVLGYTLGIILIPRFISQP 300
           G IALF YV +EVIAGDTIG +  SLGV ++  +TSYTMV MV+GY +G++ IPRFISQ 
Sbjct: 250 GAIALFAYVGIEVIAGDTIGLYGQSLGVANFASLTSYTMVFMVIGYAIGVLCIPRFISQE 309

Query: 301 TALMISAILGLLLTLAILFGDNNSYAIANALLVPFGGVALPDTLLFIAFLGLANAIVWPA 360
            AL+ SAI G L  L  +FG   S  +A+AL    G   +P++++F+A +GLA+A+VWPA
Sbjct: 310 RALLASAIAGGLCVLGAVFGSTESTTLASALWGWMGVPLVPNSVVFVAMMGLAHALVWPA 369

Query: 361 VWPLALSGLGKLTSTGSALLIMGIAGGAFGPLFWGLTSSATDMGQQGGYMVMLPCYLFIL 420
           VWPLAL GLGK T+ GSALLIMGI+GGA  PL +G  +  +   Q  GY V LPCYLFIL
Sbjct: 370 VWPLALDGLGKFTAQGSALLIMGISGGAILPLLFGKVAHFSGETQL-GYWVGLPCYLFIL 428

Query: 421 FYAVKGHKMRHW 432
           FYAVKGHKMR W
Sbjct: 429 FYAVKGHKMRSW 440


Lambda     K      H
   0.327    0.141    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 664
Number of extensions: 40
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 432
Length of database: 441
Length adjustment: 32
Effective length of query: 400
Effective length of database: 409
Effective search space:   163600
Effective search space used:   163600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory