GapMind for catabolism of small carbon sources

 

Aligments for a candidate for edd in Shewanella amazonensis SB2B

Align phosphogluconate dehydratase (EC 4.2.1.12) (characterized)
to candidate 6939185 Sama_3279 dihydroxy-acid dehydratase (RefSeq)

Query= BRENDA::Q1PAG1
         (608 letters)



>lcl|FitnessBrowser__SB2B:6939185 Sama_3279 dihydroxy-acid
           dehydratase (RefSeq)
          Length = 618

 Score =  211 bits (537), Expect = 7e-59
 Identities = 183/587 (31%), Positives = 277/587 (47%), Gaps = 55/587 (9%)

Query: 68  VAIVSSYNDMLSAHQPYEHFPEQIKKALREMGSVGQFAGGTPAMCDGVTQGEAGMELSLP 127
           +AI +S+   +  H   +     +  A+ E G + +    T A+ DG+  G  GM  SLP
Sbjct: 37  IAIANSFTQFVPGHVHLKDMGSLVASAIEEAGGIAK-EFNTIAVDDGIAMGHGGMLYSLP 95

Query: 128 SREVIALSTAVALSHNMFDAALMLGICDKIVPGLMMGALRFGHLPTIFVPGGPMPSG--- 184
           SRE+IA S    ++ +  DA + +  CDKI PG++M ALR  ++P +FV GGPM +G   
Sbjct: 96  SRELIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRL-NIPVVFVSGGPMEAGKTK 154

Query: 185 ISNK----EKADVRQRYAEGKATREELLESEMKSYHSPGTCTFYGTANTNQLLMEVMGLH 240
           +S+K    +  D     A+ + +  +  + E  +  + G+C+   TAN+   L E +GL 
Sbjct: 155 LSDKLIKLDLVDAMVAAADDRISDADSEKIERSACPTCGSCSGMFTANSMNCLTEALGLS 214

Query: 241 LPGASFVNPYTPLRDALTHEAAQQVTRLTKQ-----SGNFTPIGEIVDERSLVNSIVALH 295
           LPG   +      R  L  EA ++V +L K+       +  P   I   ++  N++    
Sbjct: 215 LPGNGSMLATHADRRELFLEAGRRVMKLAKRYYGDDDASVLP-RSIASFKAFENAMALDV 273

Query: 296 ATGGSTNHTLHMPAIAQAAGIQLTWQDMADLSEVVPTLSHVYPN-GKADINHFQAAGGMA 354
           A GGS+N  LH+ A AQ A +  T  D+  +S  VP L  V P+  K  +     AGG+ 
Sbjct: 274 AMGGSSNTVLHLLAAAQEAEVDFTMDDIDRISRKVPHLCKVAPSTPKYHMEDVHRAGGVM 333

Query: 355 FLIRELLEAGLLHEDVNTVAGR-GLSRYTQEPF---LDNGKLV---WRDGPI-------- 399
            ++ EL  AGLLH DVN VA   G  +   E F   L   + V   +R GP         
Sbjct: 334 AILGELDRAGLLHTDVNHVASEDGTLKSVLERFDVVLTKDEKVHEFFRAGPAGIPTTRAF 393

Query: 400 ------ESLD----ENILRPVARAFSPEGGLRVMEGNLGRG--VMKVSAVALQHQIVEAP 447
                 ++LD    E  +R    AFS EGGL V+ GNL     ++K + V   +      
Sbjct: 394 SQSCRWDTLDDDRREGCIRSREFAFSQEGGLAVLSGNLAENGCIVKTAGVDESNLKFSGV 453

Query: 448 AVVFQDQQDLADAFKAGELEKDFVAVMRFQGPRSNGMPELHKMTPFLGVLQDRGF--KVA 505
           A V++ Q+D       GE+    V V+RF+GP+  G P + +M      L+ RG   + A
Sbjct: 454 ARVYESQEDAVAGILGGEVVAGDVVVIRFEGPK--GGPGMQEMLYPTSYLKSRGLGTQCA 511

Query: 506 LVTDGRMSGASGKIPAAIHVSPEAQVGGALARVRDGDIIRVDGVKGTLELKVDADEFAAR 565
           L+TDGR SG +  +    HVSPEA  GG +  + +GD I +D    +++L V   E  +R
Sbjct: 512 LITDGRFSGGTSGLSIG-HVSPEAASGGTIGLIENGDRIDIDIPGRSIKLLVSDAELESR 570

Query: 566 EPAKGLLG-------NNVGSGRELFGFMRMAFSSAEQGASAFTSALE 605
             A    G       + V           M  +SA++GA    S LE
Sbjct: 571 RAAMNAKGPLAWKPLSRVRPVSMALKAYAMLATSADKGAVRDVSKLE 617


Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 911
Number of extensions: 52
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 608
Length of database: 618
Length adjustment: 37
Effective length of query: 571
Effective length of database: 581
Effective search space:   331751
Effective search space used:   331751
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory