Align 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) (characterized)
to candidate 6937210 Sama_1380 3-hydroxyisobutyrate dehydrogenase (RefSeq)
Query= BRENDA::Q8ZLV8 (296 letters) >FitnessBrowser__SB2B:6937210 Length = 301 Score = 184 bits (466), Expect = 3e-51 Identities = 107/295 (36%), Positives = 170/295 (57%), Gaps = 10/295 (3%) Query: 4 KVGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVII 63 K+ FIGLG MG PM+ NLLKAG+S+ V D NP A+ + A GA TA+AIA D ++ Sbjct: 3 KIAFIGLGNMGGPMAANLLKAGHSVSVFDLNPAAVESLKAQGAGRGDTAQAIAADADFVV 62 Query: 64 TMLPNSPHVKEVALGEN---GIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDA 120 +MLP HV+ + LG + G+IE K G +LID S+I ++R ++DA AKG+E +DA Sbjct: 63 SMLPAGKHVRGLYLGTDTAKGLIEVVKAGCLLIDCSTIDAGSARTVADAAAAKGLEFIDA 122 Query: 121 PVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGDIGAGNVTKLANQVIVA 180 PVSGG A GTL+ + GG A F+K ++ M ++ H G GAG V K+ N ++++ Sbjct: 123 PVSGGTAGAAAGTLTFICGGTDAAFEKARTVLANMGVNIFHAGGPGAGQVAKICNNMLLS 182 Query: 181 LNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDA--KAPMVMD-----RNFKPGF 233 + + SEAL+L G++P ++ ++ G+ L+ P VM+ + ++ GF Sbjct: 183 VLMVGTSEALSLGIDHGLDPKVLSDIMKVSSGGNWTLEKYNPCPGVMENVPSSKGYQGGF 242 Query: 234 RIDLHIKDLANALDTSHGVGAQLPLTAAVMEMMQALRADGHGNDDHSALACYYEK 288 +DL +KDL + + + G + P+ A + + G+G D S++ ++ K Sbjct: 243 MVDLMVKDLGLSQEAALGSQSSTPMGALARSLYVSHARAGNGTRDFSSIFEHFAK 297 Lambda K H 0.316 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 301 Length adjustment: 27 Effective length of query: 269 Effective length of database: 274 Effective search space: 73706 Effective search space used: 73706 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory