Align Sodium:dicarboxylate symporter (characterized, see rationale)
to candidate 6936407 Sama_0595 sodium:dicarboxylate symporter (RefSeq)
Query= uniprot:A1S570 (437 letters) >FitnessBrowser__SB2B:6936407 Length = 414 Score = 314 bits (804), Expect = 4e-90 Identities = 167/407 (41%), Positives = 253/407 (62%), Gaps = 15/407 (3%) Query: 11 LTGKILIGMGAGILIGLLLR------NFFGGSEWVQDYITEGFFHVIGTIFINSLKMLVV 64 L+ +I +G+ G+L G L++ NFF G+ I G +GT+F+N + MLVV Sbjct: 5 LSARIFLGLAIGLLSGTLVQYVLHDINFFSGT---LVEIASG----LGTMFVNMIMMLVV 57 Query: 65 PLVFISLVCGTCSLSEPSKLGRLGGKTLAFYLFTTAIALVVAISAAVLVQPGNA--SLAS 122 PLVF+S+VCG C L + S GRLGGKT FY+ T +A+ A++ A+L++PG Sbjct: 58 PLVFVSIVCGVCELKDLSSFGRLGGKTFGFYIINTLVAIFAALTVALLLEPGKGVDMTGG 117 Query: 123 ESMQYSAKEAPSLADVLINIVPSNPMKALSEGNMLQIIIFAVIFGFAISHIGERGRRVAA 182 + +A E PSL ++++IVP NP+ A GNMLQ+I A++ G I +GE + Sbjct: 118 GELAITATELPSLMALVVDIVPRNPVAAFMSGNMLQVIFMALLLGGVIKSLGEHVTGAVS 177 Query: 183 LFDDLNEVIMRVVTLIMQLAPYGVFALMGKLALTLGMETLESVIKYFMLVLVVLLFHGFV 242 F N+++M++++++M LAP GV ALM KL TL SV++Y +L+L +LL FV Sbjct: 178 AFQTANKIMMKLISVVMHLAPIGVGALMFKLGATLEAGVFLSVMEYLVLILGLLLLWIFV 237 Query: 243 VYPTLLKLFSGLSPLMFIRKMRDVQLFAFSTASSNATLPVTMEASEHRLGADNKVASFTL 302 VYP ++LF+ + +F K ++ LF+ STASSNAT+PVTM +L + VA F + Sbjct: 238 VYPYAVQLFTPVKASVFREKTQEQILFSLSTASSNATIPVTMRTLTEKLKVNRAVAGFGV 297 Query: 303 PLGATINMDGTAIMQGVATVFIAQVFGIDLTITDYAMVVMTATLASIGTAGVPGVGLVML 362 PLGAT+NM G +I VA FIA FG+ +T+ ++ + L S+G GVPG G+VM+ Sbjct: 298 PLGATMNMGGVSIYITVAIFFIANAFGMPITMEQLPALIFSIFLLSVGAGGVPGGGMVMI 357 Query: 363 AMVLNQVGLPVEGIALILGVDRMLDMVRTAVNVTGDTVATVVIAKSE 409 ++++Q+GLPVE AL+ +DR++DMV T+ NV GDT ++ ++E Sbjct: 358 GVLIHQMGLPVEAFALVAALDRLIDMVLTSCNVVGDTAVLTIVDQTE 404 Lambda K H 0.325 0.139 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 414 Length adjustment: 32 Effective length of query: 405 Effective length of database: 382 Effective search space: 154710 Effective search space used: 154710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory