Align GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter (characterized)
to candidate 6938424 Sama_2543 C4 dicarboxylate ABC transporter permease (RefSeq)
Query= TCDB::P74224 (445 letters) >FitnessBrowser__SB2B:6938424 Length = 453 Score = 446 bits (1147), Expect = e-130 Identities = 228/451 (50%), Positives = 312/451 (69%), Gaps = 22/451 (4%) Query: 10 MMFVGALVFLGCGYPVAFSLGGVAILFAIIGAALGSFDPIFLSAMPQRIFGIMANGTLLA 69 ++F+ + L GYPVA +LGGVA LFA+ + G+FD +P RIFGI+ N L+A Sbjct: 4 LLFLIICLVLMLGYPVALTLGGVAFLFALFASFFGAFDMGLFGLLPNRIFGILNNQILMA 63 Query: 70 IPFFIFLGSMLERSGIAEQLLETMGIILGHLRGGLALAVILVGTMLAATTGVVAATVVAM 129 +P F+F+G +LE+S IAEQLL TMG +LG RGGL +V VG +LAA+TG+V ATVV M Sbjct: 64 VPLFVFMGVVLEKSRIAEQLLTTMGALLGRFRGGLIFSVFFVGVLLAASTGIVGATVVTM 123 Query: 130 GLISLPIMLRYGYSKELASGVIVASGTLGQIIPPSVVLIVLADQLG-------------- 175 GL+SLP +L+ GYS EL++G I A+GTLGQIIPPS+ L++L D L Sbjct: 124 GLMSLPTLLKRGYSPELSAGAICATGTLGQIIPPSIALVLLGDVLSNAYQQAQLKMGIFN 183 Query: 176 ---VSVGDLFIGSLLPGLMMAGSFALYVLIIAWLKP-DLAPALPAEVRNIGGQELRRRIV 231 VSVGDLF G+L+PGLM+ + Y L W P D A+ + R++ Sbjct: 184 PKSVSVGDLFAGALIPGLMLVSLYMFYTLFRLWRSPADFGSAITQDYEPAS----LARVI 239 Query: 232 QVMLPPLVLILLVLGSIFFGIASPTEAGAVGSIGAIALAHFNQRLNWKALWEVCDATLRI 291 +LPPL+LI LVLGSI GIA+PTEA +VG+ GA+ +A ++++ AL EV +T++I Sbjct: 240 SALLPPLLLIFLVLGSILAGIATPTEAASVGAAGALLIALLKRQMSMLALKEVMQSTVKI 299 Query: 292 TSMVMLILLGSTAFSLVFRGLEGDRFMFDLLANLPGGQIGFLAISMITIFILGFFIDFFE 351 TSMV LIL+G++ FSLVFRGL G+ + +L AN+PGG +G + + M IF+LGF +DF E Sbjct: 300 TSMVFLILIGASVFSLVFRGLGGEELIHNLFANMPGGVVGAMLLVMTVIFVLGFILDFIE 359 Query: 352 IAFIVLPLFKPVAEALNLDLIWYGVIVGANLQTSFLTPPFGFALFYLRGVAPASLTTGQI 411 I F+V+PL P+ A+ LD +W G+++ NLQTSFLTPPFGFALFYLRGV+ S+++GQI Sbjct: 360 ITFVVVPLVAPILLAMGLDPVWLGIMIALNLQTSFLTPPFGFALFYLRGVSGDSVSSGQI 419 Query: 412 YRGAVPFIGLQVLVLLLIIIFPALINWLPSL 442 YRG +PF+ LQ+L+L+L+ I+PAL WLPS+ Sbjct: 420 YRGVIPFVILQLLMLILLGIWPALATWLPSV 450 Lambda K H 0.331 0.148 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 640 Number of extensions: 41 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 453 Length adjustment: 33 Effective length of query: 412 Effective length of database: 420 Effective search space: 173040 Effective search space used: 173040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory