Align Glycerol-3-phosphate dehydrogenase; EC 1.1.5.3 (characterized, see rationale)
to candidate 6936441 Sama_0629 glycerol-3-phosphate dehydrogenase (RefSeq)
Query= uniprot:Q92LM5 (503 letters) >FitnessBrowser__SB2B:6936441 Length = 404 Score = 181 bits (458), Expect = 6e-50 Identities = 127/383 (33%), Positives = 189/383 (49%), Gaps = 17/383 (4%) Query: 8 DVFVIGGGINGCGIARDAAGRGYSVALAEMSDFASGTSSGSTKLIHGGLRYLEHYEFRLV 67 DV V+GGGI G GIA+ AA GYSVAL E TS S+KLIHGGLRYLE + LV Sbjct: 5 DVLVVGGGIAGVGIAQFAAAAGYSVALIERQRIGEATSGNSSKLIHGGLRYLETMQLDLV 64 Query: 68 REALMEREVLWAMAPHVIWPMRFVLPFHKGGPRPAWLIRLGLFLYDHIGGRKLLPATKTL 127 R++L ER L +AP ++ + F P ++ R A IR GL LY + L KTL Sbjct: 65 RKSLKERRALLQLAPSLVTAVPFYFPVYRNSRRGALTIRAGLSLYGLLSEFDALGRFKTL 124 Query: 128 DMTRDPAGAPLKGL----FTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVVSAR 183 ++ + L+GL F+Y D DD L A A G + V + Sbjct: 125 SKSQ---WSRLQGLNSAGLETVFQYWDAQTDDRLLCEAVAHSAILLGTDVFEWAEVEHIQ 181 Query: 184 REGGRWAIEIESTETGARETMRARMLVNAAGPWVDRVLSEAVGNNDVRNVRLVQGSHIVV 243 G ++ T+ G + ++A +++NA GPWV+++L + VQG+H+++ Sbjct: 182 HSGD--GCQVSFTQQGQQHDIQAGVVINACGPWVNQLLERVTPTVSALEIDWVQGAHLLL 239 Query: 244 KKKFDDPRAYFFQNPDGRIMFAIPYQDEFTLIGTTDRDFTGNPADVRISDAEIDYLCRAA 303 D Y D R++F +P+ + TL+GTT+ T +++AE YL Sbjct: 240 DIPPVDGVLYLESPIDQRVVFVMPWYGK-TLVGTTETRLTHLDNKPAVTEAEKRYLLALY 298 Query: 304 SEYFSDPVGRED-----IVWTYSAVRPLFDDGASKAQEATRDYVLRVENGDAPLLNVFGG 358 + YF D G+ D + T+ VR L G A A RD ++ LL+++GG Sbjct: 299 AHYFPD-AGKVDELEKKVTDTFCGVRVLPRSGGD-AFHAPRDTLMHTCRSHPRLLSLYGG 356 Query: 359 KLTTYRRLAESALEKIGETIGEK 381 KLTT+R A L+ + +G++ Sbjct: 357 KLTTFRSSAAEVLDWVRAQLGDR 379 Lambda K H 0.321 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 503 Length of database: 404 Length adjustment: 33 Effective length of query: 470 Effective length of database: 371 Effective search space: 174370 Effective search space used: 174370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory