Align ABC transporter related (characterized, see rationale)
to candidate 6938761 Sama_2864 ABC transporter related (RefSeq)
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__SB2B:6938761 Length = 230 Score = 141 bits (355), Expect = 1e-38 Identities = 87/229 (37%), Positives = 130/229 (56%), Gaps = 17/229 (7%) Query: 9 LSVKNIHKSFG----DHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGS 64 L++KNI+K F + H L+ +L+ +G+ +++ G SGSGK+TFL LLE G Sbjct: 2 LTMKNINKLFRTDLVETHALRDFNLEVAEGEFVAVTGPSGSGKTTFLNIAGLLENASGGE 61 Query: 65 VSLAGEELKMKRRGDGKLQPSDRRQVDRVRSQ-LGMVFQNFNLWSHMTVLENLIEGPMRV 123 L GE + L S RVR+Q +G +FQ FNL + + EN +E P+R Sbjct: 62 YWLDGENV-------ANLSDS---AAARVRNQKIGFIFQGFNLIPDLNLAEN-VELPLRY 110 Query: 124 QKRSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTS 183 + +E E L++VGLA ++ H P+ LSGGQQQRVAIARALA P+ +L DEPT Sbjct: 111 RGFGSSERKRRVEQALSQVGLAARQKHLPSQLSGGQQQRVAIARALAGEPRFLLADEPTG 170 Query: 184 ALDPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQV 232 LD + +V+ ++ + +G T+++VTH+ AR + + GQV Sbjct: 171 NLDSLMARQVMELLEDINRQGTTIIMVTHDGELARRAERNIQIV-DGQV 218 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 230 Length adjustment: 24 Effective length of query: 239 Effective length of database: 206 Effective search space: 49234 Effective search space used: 49234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory