Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)
to candidate 6937298 Sama_1468 putative macrolide efflux ABC transporter, ATP-binding protein (RefSeq)
Query= reanno::Smeli:SMc02121 (258 letters) >FitnessBrowser__SB2B:6937298 Length = 230 Score = 127 bits (320), Expect = 2e-34 Identities = 83/210 (39%), Positives = 125/210 (59%), Gaps = 10/210 (4%) Query: 30 DFHVLRDINLRVMRGERIVVAGPSGSGKSTMIRCINRLEEHQKGKIVVDGIE---LTNDL 86 + LR +++ + + E + + GPSGSGKST++ I L+ G +++G L++D Sbjct: 17 EVQALRGVDIHIRQNEFVAIMGPSGSGKSTLMNIIGCLDRPTSGNYLLNGSAVGGLSDDA 76 Query: 87 KKIDEVR-REVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKEAEQVAMHFLERVKIPE 145 + VR RE+G VFQ F+L P L+ L+N L P+ + P+ + Q A+ LERV + + Sbjct: 77 --LSAVRNREIGFVFQSFHLLPRLSALDN-VLLPLRFSETPRGD-RQHAIELLERVGLGQ 132 Query: 146 QALKYPGQLSGGQQQRVAIARSLCMRPKILLFDEPTSALDPEMVKEVLDTMVGLAEEGMT 205 + P QLSGGQ+QRVAIAR+L RP +LL DEPT ALD + E++ L G T Sbjct: 133 RLDHRPNQLSGGQRQRVAIARALVNRPTLLLADEPTGALDSKTSVEIMALFDELHLSGQT 192 Query: 206 MICVTHEMGFARQVANRVIFMDQGQIVEQN 235 ++ VTHE A + A R+I M G +V+Q+ Sbjct: 193 IVLVTHEEEVA-ECAGRIIRMRDG-VVQQD 220 Lambda K H 0.322 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 230 Length adjustment: 24 Effective length of query: 234 Effective length of database: 206 Effective search space: 48204 Effective search space used: 48204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory