Align short chain enoyl-CoA hydratase subunit (EC 4.2.1.17) (characterized)
to candidate 6937190 Sama_1360 enoyl-CoA hydratase/isomerase (RefSeq)
Query= metacyc::MONOMER-11697 (290 letters) >FitnessBrowser__SB2B:6937190 Length = 276 Score = 89.0 bits (219), Expect = 1e-22 Identities = 81/265 (30%), Positives = 119/265 (44%), Gaps = 22/265 (8%) Query: 30 SAAFEYIITAKKGRNSNVGLIQLNRPKALNALCNGLIVELNQALQAFEEDPAVGAIVLTG 89 SA+F I GR VG + LNRP+ NA +I E+ QA+ AF + +VL Sbjct: 11 SASFSRIRLELNGR---VGYLILNRPEVHNAFDEVMISEMTQAINAFAHESECAVMVLKS 67 Query: 90 GEKVFAAGADIKEMQ---SLTFQNCYSGG--FLSHWDQLTRVKKPVIAAVNGYALGGGCE 144 K F+AGAD+ M+ ++ F + + D L R KP IA VNG A GG Sbjct: 68 DGKHFSAGADLNWMRKQAAMDFDDNLKDARELANLMDTLDRFPKPSIALVNGAAYGGALG 127 Query: 145 LAMMCDIIYAGEKAQFGQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAK 204 L CDI + KA F E+ +G IP A + + RA+G + +LT +R A A Sbjct: 128 LVCCCDIAISSHKASFCLSEVKLGLIP-AVISPYVVRAMGPRQSRRYMLTAERFDASMAL 186 Query: 205 QAGLVSKIFPVETVVEEAIQCAEKIASNSKIVTAMAKESVNAAFEMTLAEGVKLEKKLFY 264 G+V +I + + A + + S S K + L GV E Y Sbjct: 187 ALGVVHEI--ADDLDAAAAPIIQNLLSGSPQALGWCKSLI-----ARLQSGVIDEHTRDY 239 Query: 265 ST------FATEDRKEGMAAFVEKR 283 ++ + + +EG+ AF +KR Sbjct: 240 TSERIARIRVSAEGQEGLNAFFDKR 264 Lambda K H 0.319 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 276 Length adjustment: 26 Effective length of query: 264 Effective length of database: 250 Effective search space: 66000 Effective search space used: 66000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory