Align Enoyl-CoA hydratase AFT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 (characterized)
to candidate 6938954 Sama_3052 enoyl-CoA hydratase/isomerase family protein (RefSeq)
Query= SwissProt::Q96VB3 (296 letters) >FitnessBrowser__SB2B:6938954 Length = 246 Score = 103 bits (256), Expect = 5e-27 Identities = 74/245 (30%), Positives = 115/245 (46%), Gaps = 9/245 (3%) Query: 21 DADGIAVIVLARSQSRNALTLPMLTDMVQLLSAMDADDSVKCIVFTGEGPFFCSGVDLTE 80 D DG+ VI R + RNAL L M + + L ++D+ ++ + TGE F SG D+ + Sbjct: 8 DLDGVRVISFNRPEKRNALDLDMYRQLTEYLMQGESDNDIRAFLLTGEANCFTSGNDVAD 67 Query: 81 GF--GEIGKTRDTHRDAGGKLALAIHNCRKPTIAAINGTAVGVGITMTLPMSIRIAAKTA 138 E+G R + RKP +AA++G+AVG+G T+ L + A +A Sbjct: 68 FLQNSELGPNHPAVR-----FLYCLLELRKPLVAAVSGSAVGIGTTLLLHCDLVYADNSA 122 Query: 139 KISFPFVRRGIVADAASSFYLPRLIGYGRALHLFTTGALYPAESGLLHGLFSETVNAASS 198 K PFV +V +A +S LP L+GY +A L + AE+ L L + + + Sbjct: 123 KFQLPFVNLALVPEAGASILLPELVGYQKAAELLLLAEPFDAETALSLKLIN-ALCSKEE 181 Query: 199 TLPRALEVARDIAVNASQVGVYLTRDLVYRSPRSPEQAHLLESAALYTRYQSRDFEEGVQ 258 AL+ AR +A Q + TR L+ + LE A R +S + + Q Sbjct: 182 LQQTALDKARKLASQPPQ-ALQQTRQLMRPHKHRVQHQMHLELEAFGERLKSDEAKARFQ 240 Query: 259 SFLEK 263 +FL K Sbjct: 241 AFLTK 245 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 246 Length adjustment: 25 Effective length of query: 271 Effective length of database: 221 Effective search space: 59891 Effective search space used: 59891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory