Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate 6937828 Sama_1969 ABC transporter, ATP-binding protein (RefSeq)
Query= TCDB::Q8DQH7 (236 letters) >FitnessBrowser__SB2B:6937828 Length = 301 Score = 106 bits (264), Expect = 6e-28 Identities = 65/214 (30%), Positives = 110/214 (51%), Gaps = 5/214 (2%) Query: 1 MSVLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKI 60 MS++ NL+ YG A+ DVS +V G V+L+G NGAGKTT++ + G ++P G + Sbjct: 1 MSLIVTRNLTKRYGSKTALDDVSLQVEAGAPVALVGPNGAGKTTLMSLMCGYIQPDGGSL 60 Query: 61 EFLGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVF 120 E LG +P + + G + +P+ + P +V E L A L+ ++ + Sbjct: 61 EILGH----VPGSRQLLGKVCALPQDALLDPNFSVGEQLSFFASLQGFSAKDARREAERV 116 Query: 121 SRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQ 180 L++ LS G + +A+ +AL+ TP+L+LLDEP+ GL P + + ++I Sbjct: 117 LELVELKDAARHKPTALSHGMGKRVAIAQALIGTPQLVLLDEPTAGLDPANARAVRELIS 176 Query: 181 DIQKQGTTVLLIEQNANKALAISDRGYVLETGKI 214 +Q TT L+ N + + D L+ GK+ Sbjct: 177 HASEQ-TTFLISSHNLEELERLCDTVLYLDKGKL 209 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 301 Length adjustment: 25 Effective length of query: 211 Effective length of database: 276 Effective search space: 58236 Effective search space used: 58236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory