GapMind for catabolism of small carbon sources

 

Aligments for a candidate for edd in Shewanella amazonensis SB2B

Align phosphogluconate dehydratase (characterized)
to candidate 6937660 Sama_1810 phosphogluconate dehydratase (RefSeq)

Query= CharProtDB::CH_024239
         (603 letters)



>lcl|FitnessBrowser__SB2B:6937660 Sama_1810 phosphogluconate
           dehydratase (RefSeq)
          Length = 608

 Score =  823 bits (2125), Expect = 0.0
 Identities = 405/600 (67%), Positives = 493/600 (82%)

Query: 1   MNPQLLRVTNRIIERSRETRSAYLARIEQAKTSTVHRSQLACGNLAHGFAACQPEDKASL 60
           M+P +  VT+RIIERS+E+RSAYLA +++A++  VHRS L+CGNLAHGFAAC  EDK SL
Sbjct: 1   MHPVVKSVTDRIIERSKESRSAYLAALQEARSGKVHRSALSCGNLAHGFAACGAEDKQSL 60

Query: 61  KSMLRNNIAIITSYNDMLSAHQPYEHYPEIIRKALHEANAVGQVAGGVPAMCDGVTQGQD 120
           + + + NI I+T++NDMLSAHQPYEHYPE+++ A +E  +V QVAGGVPAMCDGVTQGQ 
Sbjct: 61  RQLTKVNIGIVTAFNDMLSAHQPYEHYPELLKAACNEVGSVAQVAGGVPAMCDGVTQGQP 120

Query: 121 GMELSLLSREVIAMSAAVGLSHNMFDGALFLGVCDKIVPGLTMAALSFGHLPAVFVPSGP 180
           GMELSLLSREVIAM+ AVGLSHNMFDGAL LGVCDKIVPGL + A+SFGHLP +FVP+GP
Sbjct: 121 GMELSLLSREVIAMATAVGLSHNMFDGALLLGVCDKIVPGLLIGAMSFGHLPMLFVPAGP 180

Query: 181 MASGLPNKEKVRIRQLYAEGKVDRMALLESEAASYHAPGTCTFYGTANTNQMVVEFMGMQ 240
           M SG+PNKEK R+RQ +AEGKVDR ALLE+EA+SYH+ GTCTFYGTAN+NQ+V+E MG+Q
Sbjct: 181 MRSGIPNKEKARVRQKFAEGKVDREALLEAEASSYHSAGTCTFYGTANSNQLVLEVMGLQ 240

Query: 241 LPGSSFVHPDSPLRDALTAAAARQVTRMTGNGNEWMPIGKMIDEKVVVNGIVALLATGGS 300
           LPGSSFV+PD PLR  L+  AA+QV R+T NG ++ PIG++++EK VVNGIVALLATGGS
Sbjct: 241 LPGSSFVNPDDPLRTELSKMAAKQVCRLTENGLQYSPIGEIVNEKSVVNGIVALLATGGS 300

Query: 301 TNHTMHLVAMARAAGIQINWDDFSDLSDVVPLMARLYPNGPADINHFQAAGGVPVLVREL 360
           TN TMH+VA ARAAGI INWDDFS+LSD VPL+AR+YPNG ADINHF AAGG+  L++EL
Sbjct: 301 TNLTMHIVAAARAAGIIINWDDFSELSDAVPLLARVYPNGHADINHFHAAGGMAFLMKEL 360

Query: 361 LKAGLLHEDVNTVAGFGLSRYTLEPWLNNGELDWREGAEKSLDSNVIASFEQPFSHHGGT 420
           L AGL+HEDVNTVAG+GL RYT EP L +G+L W +G   SLD  V+    +PF  +GG 
Sbjct: 361 LDAGLIHEDVNTVAGYGLRRYTQEPRLIDGQLTWVDGPVTSLDQEVLRGVAEPFQSNGGL 420

Query: 421 KVLSGNLGRAVMKTSAVPVENQVIEAPAVVFESQHDVMPAFEAGLLDRDCVVVVRHQGPK 480
           K++ GNLGRAV+K SAV  +++++EAPAVV + Q+ +   F+AG LDRDCVVVV+ QGPK
Sbjct: 421 KLMKGNLGRAVIKVSAVQEQHRIVEAPAVVIDDQNKLDALFKAGELDRDCVVVVKGQGPK 480

Query: 481 ANGMPELHKLMPPLGVLLDRCFKIALVTDGRLSGASGKVPSAIHVTPEAYDGGLLAKVRD 540
           ANGMPELHKL P LG L DR FK+AL+TDGR+SGASGKVP+AIH+TPEA DGGL+AKV+D
Sbjct: 481 ANGMPELHKLTPILGTLQDRGFKVALMTDGRMSGASGKVPAAIHLTPEALDGGLIAKVQD 540

Query: 541 GDIIRVNGQTGELTLLVDEAELAAREPHIPDLSASRVGTGRELFSALREKLSGAEQGATC 600
           GD+IR+N  TGEL+LLV   EL +R     +L  SR G GRELF ALR+ LS  E GA C
Sbjct: 541 GDLIRINAITGELSLLVSAPELESRTAAPVELRKSRYGMGRELFGALRQNLSSPETGARC 600


Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1090
Number of extensions: 41
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 603
Length of database: 608
Length adjustment: 37
Effective length of query: 566
Effective length of database: 571
Effective search space:   323186
Effective search space used:   323186
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

Align candidate 6937660 Sama_1810 (phosphogluconate dehydratase (RefSeq))
to HMM TIGR01196 (edd: phosphogluconate dehydratase (EC 4.2.1.12))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01196.hmm
# target sequence database:        /tmp/gapView.27880.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01196  [M=601]
Accession:   TIGR01196
Description: edd: phosphogluconate dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
          0 1017.9   0.7          0 1017.7   0.7    1.0  1  lcl|FitnessBrowser__SB2B:6937660  Sama_1810 phosphogluconate dehyd


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__SB2B:6937660  Sama_1810 phosphogluconate dehydratase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1017.7   0.7         0         0       1     599 [.       2     600 ..       2     602 .. 1.00

  Alignments for each domain:
  == domain 1  score: 1017.7 bits;  conditional E-value: 0
                         TIGR01196   1 hsrlaeiteriierskktrekylekirsaktkgklrstlgcgnlahgvaalsesekvelksekrknlaiitayndml 77 
                                       h+ ++++t+riiersk+ r++yl+ +++a++  ++rs+l+cgnlahg+aa+  ++k++l++ ++ n++i+ta+ndml
  lcl|FitnessBrowser__SB2B:6937660   2 HPVVKSVTDRIIERSKESRSAYLAALQEARSGKVHRSALSCGNLAHGFAACGAEDKQSLRQLTKVNIGIVTAFNDML 78 
                                       677899*********************************************************************** PP

                         TIGR01196  78 sahqpfkeypdlikkalqeanavaqvagGvpamcdGvtqGedGmelsllsrdvialstaiglshnmfdgalflGvcd 154
                                       sahqp+++yp+l+k a++e ++vaqvagGvpamcdGvtqG++Gmelsllsr+via++ta+glshnmfdgal+lGvcd
  lcl|FitnessBrowser__SB2B:6937660  79 SAHQPYEHYPELLKAACNEVGSVAQVAGGVPAMCDGVTQGQPGMELSLLSREVIAMATAVGLSHNMFDGALLLGVCD 155
                                       ***************************************************************************** PP

                         TIGR01196 155 kivpGlliaalsfGhlpavfvpaGpmasGlenkekakvrqlfaeGkvdreellksemasyhapGtctfyGtansnqm 231
                                       kivpGlli+a+sfGhlp +fvpaGpm sG++nkeka+vrq faeGkvdre+ll++e++syh++GtctfyGtansnq+
  lcl|FitnessBrowser__SB2B:6937660 156 KIVPGLLIGAMSFGHLPMLFVPAGPMRSGIPNKEKARVRQKFAEGKVDREALLEAEASSYHSAGTCTFYGTANSNQL 232
                                       ***************************************************************************** PP

                         TIGR01196 232 lvelmGlhlpgasfvnpntplrdaltreaakrlarltakngevlplaelideksivnalvgllatGGstnhtlhlva 308
                                       ++e+mGl+lpg+sfvnp+ plr +l++ aak++ rlt ++ ++ p++e+++eks+vn++v+llatGGstn t+h+va
  lcl|FitnessBrowser__SB2B:6937660 233 VLEVMGLQLPGSSFVNPDDPLRTELSKMAAKQVCRLTENGLQYSPIGEIVNEKSVVNGIVALLATGGSTNLTMHIVA 309
                                       ***************************************************************************** PP

                         TIGR01196 309 iaraaGiilnwddlselsdlvpllarvypnGkadvnhfeaaGGlsflirellkeGllhedvetvagkGlrrytkepf 385
                                        araaGii+nwdd+selsd vpllarvypnG+ad+nhf+aaGG++fl++ell++Gl+hedv+tvag Glrryt+ep 
  lcl|FitnessBrowser__SB2B:6937660 310 AARAAGIIINWDDFSELSDAVPLLARVYPNGHADINHFHAAGGMAFLMKELLDAGLIHEDVNTVAGYGLRRYTQEPR 386
                                       ***************************************************************************** PP

                         TIGR01196 386 ledgkleyreaaeksldedilrkvdkpfsaeGGlkllkGnlGravikvsavkeesrvieapaivfkdqaellaafka 462
                                       l dg+l++ +++ +sld+++lr v +pf+++GGlkl+kGnlGravikvsav+e++r++eapa+v +dq++l a fka
  lcl|FitnessBrowser__SB2B:6937660 387 LIDGQLTWVDGPVTSLDQEVLRGVAEPFQSNGGLKLMKGNLGRAVIKVSAVQEQHRIVEAPAVVIDDQNKLDALFKA 463
                                       ***************************************************************************** PP

                         TIGR01196 463 gelerdlvavvrfqGpkanGmpelhklttvlGvlqdrgfkvalvtdGrlsGasGkvpaaihvtpealegGalakird 539
                                       gel+rd+v+vv+ qGpkanGmpelhklt+ lG lqdrgfkval+tdGr+sGasGkvpaaih+tpeal+gG +ak++d
  lcl|FitnessBrowser__SB2B:6937660 464 GELDRDCVVVVKGQGPKANGMPELHKLTPILGTLQDRGFKVALMTDGRMSGASGKVPAAIHLTPEALDGGLIAKVQD 540
                                       ***************************************************************************** PP

                         TIGR01196 540 GdlirldavngelevlvddaelkareleeldlednelGlGrelfaalrekvssaeeGass 599
                                       Gdlir++a++gel++lv   el++r+ + ++l ++++G+Grelf alr+++ss e+Ga +
  lcl|FitnessBrowser__SB2B:6937660 541 GDLIRINAITGELSLLVSAPELESRTAAPVELRKSRYGMGRELFGALRQNLSSPETGARC 600
                                       *********************************************************987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (601 nodes)
Target sequences:                          1  (608 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03
# Mc/sec: 11.89
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory