Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate 6938846 Sama_2949 D-3-phosphoglycerate dehydrogenase (RefSeq)
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__SB2B:6938846 Length = 409 Score = 145 bits (367), Expect = 1e-39 Identities = 104/290 (35%), Positives = 147/290 (50%), Gaps = 15/290 (5%) Query: 33 DAFVAALKDADG-GIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANT 91 +A VA++KDA GI S +++ +L A +L + +G +Q D+ GI + N Sbjct: 45 EALVASIKDAHFVGIRSRTQLSAEVLSKAEKLVGIGCFCIGTNQVDLKSAELAGIPVFNA 104 Query: 92 PDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGR 151 P T S A+ V I+ R + + G W S + V+V+GKTLG++G G Sbjct: 105 PFSNTRSVAELVLGEIIMLMRGIPQRNALCHRGGWLKSANGS---VEVRGKTLGVIGYGH 161 Query: 152 IGGAVARRA-ALGFNMKVL-YTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTPE 209 IG + A LG +K ++ A++ + ELLA AD V L VP TP+ Sbjct: 162 IGTQLGILAETLGMRVKFFDIEDKLPLGNAQQVHS-----FEELLANADVVSLHVPETPQ 216 Query: 210 TKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSD-- 267 TK++IG EL +MKK + LINASRG VD AL AL+ I GA +DVF EP +D Sbjct: 217 TKNMIGHTELATMKKGSFLINASRGTVVDIDALSAALKEEHIAGAAIDVFPVEPKSNDDV 276 Query: 268 --SPLLKLANVVALPHIGSATHETRHAMARNAAENLVAALDGTLTSNIVN 315 SPL L NV+ PH+G +T E + + A L D T + VN Sbjct: 277 FQSPLRGLDNVILTPHVGGSTEEAQENIGIEVAGKLAKYSDNGSTVSAVN 326 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 409 Length adjustment: 29 Effective length of query: 292 Effective length of database: 380 Effective search space: 110960 Effective search space used: 110960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory