GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ptsG-crr in Shewanella amazonensis SB2B

Align PTS system glucose-specific EIICBA component; EIICBA-Glc; EII-Glc; EIICBA-Glc 1; EC 2.7.1.199 (characterized)
to candidate 6936959 Sama_1133 PTS system, glucose-specific IIBC component (RefSeq)

Query= SwissProt::Q57071
         (675 letters)



>lcl|FitnessBrowser__SB2B:6936959 Sama_1133 PTS system,
           glucose-specific IIBC component (RefSeq)
          Length = 485

 Score =  321 bits (822), Expect = 6e-92
 Identities = 189/504 (37%), Positives = 290/504 (57%), Gaps = 43/504 (8%)

Query: 3   KKFFGQLQRIGKALMLPVAILPAAGLLLALGNAFQGDALQSLMPFIKAEGFQNVAK-MME 61
           + +F   QR+ + L++P+AILPAAG+++ +          + +PFI      +VA  +M 
Sbjct: 17  RHWFRFAQRLSQTLLIPIAILPAAGVMIGIAT--------NPLPFIP-----DVANVLML 63

Query: 62  GAGGIIFDNLAIIFALGVAIGLASGDGVAAIAAFVGFIVLNKTMGMFLGV--TPEKAADA 119
             G +IFD + ++FA+ VAIG     G+AA +A  G+ VL  T+     V   P      
Sbjct: 64  SVGKLIFDIMPMLFAIAVAIGFCRDQGIAAFSAAFGYGVLLSTLAAAAKVYHLPSHI--- 120

Query: 120 ATGFANVLGIPTLQTGVFGGIIIGALAAWCYNKFYNISLPSYLGFFAGKRFVPIMMATCS 179
                 V G PT+ TG+ GG+++G +          + LP+   FF G+R  P++M    
Sbjct: 121 ------VWGTPTIDTGIAGGMLVGGITCVAVRLSEKLRLPAVFSFFEGRRSAPLIMIPLV 174

Query: 180 FILAFPMAIIWPSIQGGLNAFSEGLLASNTGLAVFLFGFIKRLLIPFGLHHIFHAPFWFE 239
            +LA  +A IWP +   +   S+  +     +A   +G ++RLL+P GLHHI++APF+ E
Sbjct: 175 MLLAVMLAFIWPPLALSIERLSDWAVYQEPAIAFGFYGMVERLLLPLGLHHIWNAPFYLE 234

Query: 240 FGSYKNAAGQIIHGDQRIFIEQIRDNVPLTAGKFMQGEFPVMMFGLPAAALAIYQTAKKE 299
            G Y +  G+I+ G+   +          +AG  + G + + M+GLPAAALAI++ A + 
Sbjct: 235 VGQYAHD-GEIVRGEMARYFAG-----DPSAGN-LAGGYLIKMWGLPAAALAIWRCADRN 287

Query: 300 NKKVVAGLMLSGALTSFLTGITEPLEFSFLFVAPLLFFIHAVLDGLSFLILYLLDLHLGY 359
            +  VAG+MLS A  S+LTG+TEP+EF+FLFVAPLL+  HA+L GL++ I  LLD+H   
Sbjct: 288 QRNRVAGVMLSAATASWLTGVTEPIEFAFLFVAPLLYLCHALLTGLAYSIAILLDMHHSV 347

Query: 360 TFSGGFIDFFLLGILPNKTQW-WLVIPVGLVYAAIYYIIFRFLIVKFNFKTPGREDKEV- 417
            FS G +DF LL    + T W W + P+  V   IYYI+FR  I+ FN KTPGR + +  
Sbjct: 348 VFSHGLVDFVLLFPQSSNTHWIWFLGPLTFV---IYYILFRASILAFNLKTPGRFEADTG 404

Query: 418 KSSNVAASELPFKVLDAMGGKANIKHLDACITRLRVEVNDKAKVDVQELKDLGASGVLEV 477
           +  N+ A      ++ A+GG  NI  L AC+TRLR+ V D ++VD Q L  LGA GV+ V
Sbjct: 405 QKRNLIA------IVSALGGGGNIADLSACLTRLRISVADPSQVDRQRLMSLGAKGVIVV 458

Query: 478 GNNMQAIFGPKSDQIKHDMQQIMD 501
           G+ +Q +FG K++ ++  +Q+ +D
Sbjct: 459 GSGVQLVFGTKAETLRKLLQRYLD 482


Lambda     K      H
   0.324    0.143    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 774
Number of extensions: 35
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 675
Length of database: 485
Length adjustment: 36
Effective length of query: 639
Effective length of database: 449
Effective search space:   286911
Effective search space used:   286911
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory