Align Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; MCCase subunit alpha; 3-methylcrotonyl-CoA carboxylase 1; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.4 (characterized)
to candidate 6936392 Sama_0580 acetyl-CoA carboxylase multifunctional enzyme accADC, carboxyl transferase subunit alpha/carboxyl transferase subunit beta/biotin carboxylase (RefSeq)
Query= SwissProt::Q2QMG2 (737 letters) >FitnessBrowser__SB2B:6936392 Length = 1517 Score = 305 bits (782), Expect = 9e-87 Identities = 182/459 (39%), Positives = 263/459 (57%), Gaps = 14/459 (3%) Query: 39 VEKVLVANRGEIACRVMRTARRLGIPTVAVYSDADRGALH---VRAADEAVRLGPPPARE 95 ++KVLV RG A +++R A I V V SD D A+ ++ D+ V LG + E Sbjct: 940 IDKVLVHARGCTAVKLIRKAHDNNINVVLVASDPDMTAVPADMLKENDKLVCLGGNTSDE 999 Query: 96 SYLNASAIVDAALRTGAKAIHPGYGFLSESADFAQLCKAEGLTFIGPPPSAIRDMGDKSA 155 SYLNA +++ A A+HPG GFLSES FA LC G+ F+GP ++ MG+KS Sbjct: 1000 SYLNAYSVLKVAEYENVDALHPGIGFLSESPQFAALCVNNGVNFVGPSVHSMTTMGNKSN 1059 Query: 156 SKRIMGAAGVPLVPGYHGAEQDIELLKLEANKIGYPVLIKPTHGGGGKGMRIVQRPEDFV 215 + + A VP+VPG HG + E A++IGYPVL+K GGGGKG+++V+RPED + Sbjct: 1060 AIKTSQAQNVPVVPGSHGILSNAEQAVNVASEIGYPVLLKAVQGGGGKGIQVVKRPEDMI 1119 Query: 216 DSVLSAQREAAASFGINTLLVEKYITQPRHIEVQIFGDQHGNVIHLYERDCSLQRRHQKI 275 + EAAA+FG L +EKY+T RHIEVQ+ D+ GN L RDCS+QR +QK+ Sbjct: 1120 PLFMKTSTEAAAAFGNGDLYLEKYVTSLRHIEVQLLRDKFGNAKVLGLRDCSVQRNNQKV 1179 Query: 276 IEEAPAPNVTAQFRSHIGEAAVSAAKAVGYYSAGTVEFIVDTLSGEFYFMEMNTRLQVEH 335 IEE+ + + + + + S AV Y AGTVEFI + + E YFMEMNTRLQVEH Sbjct: 1180 IEESGSTMLPPELKQQVMAYTKSLGDAVDYMGAGTVEFIYNLDANEVYFMEMNTRLQVEH 1239 Query: 336 PVTEMIVGQDLVEWQIRIANGECL-PLSQEQVPLNGHAFEARIYAE------NVPRGFLP 388 PVTE G D+V Q IA G + L +++ G+A E R+ AE N +P Sbjct: 1240 PVTEATSGIDIVSAQFDIAAGRSIEDLEPQEI---GYAMEVRVTAEKAALDSNGVLQLVP 1296 Query: 389 ATGTLHHYRPVPSTATVRVETGVEEGDTVSMHYDPMIAKLVVWGESRNAALVKLKNSLSN 448 G + +P V + + EG VS +YD +IA++++ GESR + K+ + L + Sbjct: 1297 NPGKITEC-VMPERDDVEIISIAAEGKEVSPYYDSLIAQIIIRGESREDVVTKMYDYLDS 1355 Query: 449 FQIAGLPTNVGFLQELAGHSAFEKGLVDTHFIERYQNDL 487 I G+ TN+ L+ + + F +G+ DT+++ R +L Sbjct: 1356 VVIKGIATNIPLLKRILKDATFNEGVYDTNYLPRLMAEL 1394 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1839 Number of extensions: 78 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 737 Length of database: 1517 Length adjustment: 45 Effective length of query: 692 Effective length of database: 1472 Effective search space: 1018624 Effective search space used: 1018624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 58 (26.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory