Align Methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate 6939547 Sama_3635 naphthoate synthase (RefSeq)
Query= reanno::Pedo557:CA265_RS09125 (258 letters) >FitnessBrowser__SB2B:6939547 Length = 300 Score = 73.2 bits (178), Expect = 6e-18 Identities = 55/180 (30%), Positives = 86/180 (47%), Gaps = 15/180 (8%) Query: 16 ITINRPEKKNALNPQLIAELTAAFIKASEDDLVKVVILNANGDA------FSAGADLAYL 69 I NRP+ NA P+ + EL A A + V V+L NG + FS+G D Sbjct: 38 IAFNRPDCLNAFRPKTVDELYTALDHARQWSDVGCVLLTGNGPSAKGQYSFSSGGDQRIR 97 Query: 70 QQLQYNTFEENVADSN-------HLKKLFTTIYYLPKVVIAQVEGHAIAGGCGLATICDI 122 + Y E ++ H+ ++ I ++PKVVIA V G A+ GG L +CD+ Sbjct: 98 GKDGYKYEGEEAGKADVARMGRLHILEVQRLIRFMPKVVIAVVPGWAVGGGHSLHVVCDL 157 Query: 123 VFATPE-SNFGYTEVKI-GFVPAIVSCFLKEKVSESIAKEILLTGKIFSAEEALKYNLIN 180 A+ E + F T+ + F S +L + V + A+EI G +SA+EA+ ++N Sbjct: 158 TLASKEHAVFKQTDPDVASFDSGYGSAYLAKMVGQKRAREIFFLGFNYSADEAVAMGMVN 217 Lambda K H 0.318 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 300 Length adjustment: 25 Effective length of query: 233 Effective length of database: 275 Effective search space: 64075 Effective search space used: 64075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory