Align Glutarate-semialdehyde dehydrogenase; EC 1.2.1.- (characterized)
to candidate 6938545 Sama_2648 aldehyde dehydrogenase (RefSeq)
Query= SwissProt::Q9I6M5 (483 letters) >FitnessBrowser__SB2B:6938545 Length = 498 Score = 278 bits (711), Expect = 3e-79 Identities = 167/473 (35%), Positives = 261/473 (55%), Gaps = 10/473 (2%) Query: 12 QAYVDGAWVDADNGQTIKVNNPATGEIIGSVPKMGAAETRRAIEAADKALPA--WRALTA 69 +A+++G + DA +T +P G ++ V A+ A+ A + W + Sbjct: 22 RAFINGHYCDAVGKETFDCISPVDGRLLTQVASCQQADADIAVANARAVFESGVWSLQSP 81 Query: 70 KERANKLRRWFDLMIENQDDLARLMTIEQGKPLAEAKG-EIAYAASFLEWFGEEAKRIYG 128 +R + R+ +L+ + D+LA L T++ GKP+A +K ++A AA + W GE +IY Sbjct: 82 VKRKKVMIRFAELLEAHADELALLETLDMGKPIAHSKAVDVAGAARAIRWSGEAIDKIYD 141 Query: 129 DTIPGHQPDKRI-IVIKQPIGVTAAITPWNFPSAMITRKAGPALAAGCTMVLKPASQTPY 187 + P P I ++ ++P+GV AAI PWNFP M K GPALA G ++VLKP+ ++P Sbjct: 142 ELAP--TPHNEIGMITREPVGVVAAIVPWNFPMLMACWKLGPALATGNSVVLKPSEKSPL 199 Query: 188 SALALAELAERAGIPKGVFSVVTGSAGEVGGELTSNPIVRKLTFTGSTEIGRQLMAECAQ 247 +A+ +A+LA+ AG+P GV +V+ G VG L + V L FTGST+I +QLM Q Sbjct: 200 TAIRMAQLAKEAGLPDGVLNVLPGFGHTVGQALALHMDVDTLVFTGSTKIAKQLMVYAGQ 259 Query: 248 -DIKKVSLELGGNAPFIVFDDA-DLDAAVEGALISKYRNNGQTCVCANRLYVQDGVYDAF 305 ++K+V LE GG +P IVF+DA DL AA E A + N G+ C +RL V+ GV D Sbjct: 260 SNMKRVWLEAGGKSPNIVFNDAPDLKAAAEAAASAIAFNQGEVCTAGSRLLVESGVKDEL 319 Query: 306 VDKLKAAVAKLNIGNGLEAGVTTGPLIDAKAVAKVEEHIADAVSKGAKVVSGGKP--HAL 363 + + + G+ L+ T G ++D + + V +I +GAK++ GG Sbjct: 320 IKLIVKEMEAWQPGHPLDPATTCGAVVDKQQLDTVLGYIKAGHDEGAKLMCGGSQVLAET 379 Query: 364 GGTFFEPTILVDVPKNALVSKDETFGPLAPVFRFKDEAEVIAMSNDTEFGLASYFYARDL 423 GG + PT+ V ++++E FGP+ V F E +A++NDT +GLA+ + D+ Sbjct: 380 GGVYVAPTVFDGVTNQMKIAREEIFGPVMSVITFDGMDEAVAIANDTIYGLAAGVWTSDI 439 Query: 424 ARVFRVAEQLEYGMVGINTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIK 476 ++ + A+ L GMV IN + APFGG K SG GR+ S + E Y E+K Sbjct: 440 SKAHKTAKALRSGMVWINHYDGGDMTAPFGGYKQSGNGRDKSLHAFEKYTEVK 492 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 568 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 498 Length adjustment: 34 Effective length of query: 449 Effective length of database: 464 Effective search space: 208336 Effective search space used: 208336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory